BLASTX nr result
ID: Papaver22_contig00015876
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00015876 (946 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEC12443.1| chromomethylase 3 [Gossypium hirsutum] 77 6e-12 gb|AFV99136.1| CMT-type cytosine DNA-methyltransferase 3b [Malus... 75 3e-11 ref|XP_002283355.2| PREDICTED: DNA (cytosine-5)-methyltransferas... 75 3e-11 emb|CBI16477.3| unnamed protein product [Vitis vinifera] 75 3e-11 gb|AFV99137.1| CMT-type cytosine DNA-methyltransferase 3c [Malus... 74 4e-11 >gb|AEC12443.1| chromomethylase 3 [Gossypium hirsutum] Length = 824 Score = 77.0 bits (188), Expect = 6e-12 Identities = 36/52 (69%), Positives = 41/52 (78%) Frame = -2 Query: 573 GTVDVKCGGPPCQGISGLNRNRNIEDPLKDSKNFQLEVFTEIVNFLLPWFTL 418 G VDV CGGPPCQGISG NR RN ++PL+D KN QL+VFTEIV +L P F L Sbjct: 429 GDVDVICGGPPCQGISGFNRFRNKDNPLQDEKNKQLQVFTEIVEYLKPKFVL 480 >gb|AFV99136.1| CMT-type cytosine DNA-methyltransferase 3b [Malus x domestica] Length = 1096 Score = 74.7 bits (182), Expect = 3e-11 Identities = 34/52 (65%), Positives = 38/52 (73%) Frame = -2 Query: 573 GTVDVKCGGPPCQGISGLNRNRNIEDPLKDSKNFQLEVFTEIVNFLLPWFTL 418 G VDV CGGPPCQG+SG NR RN E PL D KN QLEV+ +IV +L P F L Sbjct: 574 GDVDVVCGGPPCQGVSGFNRFRNTESPLADDKNQQLEVYMDIVRYLXPKFVL 625 >ref|XP_002283355.2| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Vitis vinifera] Length = 956 Score = 74.7 bits (182), Expect = 3e-11 Identities = 35/52 (67%), Positives = 40/52 (76%) Frame = -2 Query: 573 GTVDVKCGGPPCQGISGLNRNRNIEDPLKDSKNFQLEVFTEIVNFLLPWFTL 418 G VDV CGGPPCQGISG NR RN E+PL+D KN QL VF ++VN+L P F L Sbjct: 571 GDVDVICGGPPCQGISGFNRFRNKENPLEDPKNKQLVVFMDVVNYLKPRFVL 622 >emb|CBI16477.3| unnamed protein product [Vitis vinifera] Length = 821 Score = 74.7 bits (182), Expect = 3e-11 Identities = 35/52 (67%), Positives = 40/52 (76%) Frame = -2 Query: 573 GTVDVKCGGPPCQGISGLNRNRNIEDPLKDSKNFQLEVFTEIVNFLLPWFTL 418 G VDV CGGPPCQGISG NR RN E+PL+D KN QL VF ++VN+L P F L Sbjct: 427 GDVDVICGGPPCQGISGFNRFRNKENPLEDPKNKQLVVFMDVVNYLKPRFVL 478 >gb|AFV99137.1| CMT-type cytosine DNA-methyltransferase 3c [Malus x domestica] Length = 974 Score = 74.3 bits (181), Expect = 4e-11 Identities = 34/52 (65%), Positives = 38/52 (73%) Frame = -2 Query: 573 GTVDVKCGGPPCQGISGLNRNRNIEDPLKDSKNFQLEVFTEIVNFLLPWFTL 418 G VDV CGGPPCQG+SG NR RN E PL D KN QLEV+ +IV +L P F L Sbjct: 602 GDVDVVCGGPPCQGVSGFNRFRNTESPLADEKNQQLEVYMDIVRYLKPKFVL 653