BLASTX nr result
ID: Papaver22_contig00014888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00014888 (746 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271350.1| PREDICTED: 7-alpha-hydroxysteroid dehydrogen... 70 4e-10 emb|CAN66009.1| hypothetical protein VITISV_024278 [Vitis vinifera] 70 4e-10 ref|XP_002300121.1| predicted protein [Populus trichocarpa] gi|2... 64 3e-08 dbj|BAJ34063.1| unnamed protein product [Thellungiella halophila] 62 2e-07 gb|AAB07875.1| similar to dehydrogenase encoded by GenBank Acces... 61 2e-07 >ref|XP_002271350.1| PREDICTED: 7-alpha-hydroxysteroid dehydrogenase [Vitis vinifera] gi|296082323|emb|CBI21328.3| unnamed protein product [Vitis vinifera] Length = 266 Score = 70.5 bits (171), Expect = 4e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -3 Query: 120 MENQGKKILLTTNGDEISENIALHLVKRGCRLVLMGNE 7 MENQGKK+L+T+NGDEIS NIA HL KRGCRLVLMGNE Sbjct: 1 MENQGKKVLVTSNGDEISANIAFHLAKRGCRLVLMGNE 38 >emb|CAN66009.1| hypothetical protein VITISV_024278 [Vitis vinifera] Length = 274 Score = 70.5 bits (171), Expect = 4e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -3 Query: 120 MENQGKKILLTTNGDEISENIALHLVKRGCRLVLMGNE 7 MENQGKK+L+T+NGDEIS NIA HL KRGCRLVLMGNE Sbjct: 1 MENQGKKVLVTSNGDEISANIAFHLAKRGCRLVLMGNE 38 >ref|XP_002300121.1| predicted protein [Populus trichocarpa] gi|222847379|gb|EEE84926.1| predicted protein [Populus trichocarpa] Length = 266 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -3 Query: 105 KKILLTTNGDEISENIALHLVKRGCRLVLMGNEK 4 KK+LLT+NGDEIS+NIA HLVK+GCRLVLMGNEK Sbjct: 6 KKVLLTSNGDEISQNIAFHLVKQGCRLVLMGNEK 39 >dbj|BAJ34063.1| unnamed protein product [Thellungiella halophila] Length = 267 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 120 MENQGKKILLTTNGDEISENIALHLVKRGCRLVLMGNE 7 MEN KK+L+T++GDE+S NIA HL K GCRLV+MGNE Sbjct: 1 MENPSKKVLMTSDGDEVSRNIAFHLAKHGCRLVMMGNE 38 >gb|AAB07875.1| similar to dehydrogenase encoded by GenBank Accession Number S39508; localized according to blastn similarity to EST sequences; therefore, the coding span corresponds only to an area of similarity since the initation codon and stop codon could not be precisely determined, partial [Arabidopsis thaliana] Length = 287 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -3 Query: 120 MENQGKKILLTTNGDEISENIALHLVKRGCRLVLMGNE 7 MEN K++L+T+NGDE+S NIA HL K GC+LV+MGNE Sbjct: 1 MENPAKRVLMTSNGDEVSRNIAFHLAKHGCKLVMMGNE 38