BLASTX nr result
ID: Papaver22_contig00014709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00014709 (504 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539035.1| PREDICTED: ribosome biogenesis protein BMS1 ... 54 1e-05 >ref|XP_003539035.1| PREDICTED: ribosome biogenesis protein BMS1 homolog [Glycine max] Length = 1176 Score = 54.3 bits (129), Expect = 1e-05 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -3 Query: 136 EERPPYIIAVQGPPRVGKSLLIKSLVSFYTRGNHCDMEAGPIRIL 2 +E PY++ VQGPP+VGKSLLIKSLV YT+ N D+ GPI I+ Sbjct: 86 DEPAPYVVVVQGPPQVGKSLLIKSLVKHYTKHNLPDVR-GPITIV 129