BLASTX nr result
ID: Papaver22_contig00014291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00014291 (467 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529755.1| glutathione peroxidase, putative [Ricinus co... 139 2e-31 ref|NP_001237745.1| uncharacterized protein LOC100527297 [Glycin... 139 3e-31 gb|AEG64804.1| putative glutathione peroxidase [Jatropha curcas] 136 2e-30 ref|NP_001237193.1| uncharacterized protein LOC100306590 [Glycin... 135 3e-30 ref|XP_002489307.1| hypothetical protein SORBIDRAFT_0010s007790 ... 135 3e-30 >ref|XP_002529755.1| glutathione peroxidase, putative [Ricinus communis] gi|223530753|gb|EEF32621.1| glutathione peroxidase, putative [Ricinus communis] Length = 167 Score = 139 bits (351), Expect = 2e-31 Identities = 65/88 (73%), Positives = 79/88 (89%) Frame = +2 Query: 2 THDEIKEVARSKFKAEFPVFAKIDVNGKDAAPLYQFLKSQKGGLFGNAIKWNFTKFLVNK 181 +++EI+EVA + FKAEFP+F KI+VNGK+ APLY++LKS+KGG FG+AIKWNFTKFLVNK Sbjct: 80 SNEEIQEVACTMFKAEFPIFDKIEVNGKNTAPLYKYLKSEKGGYFGDAIKWNFTKFLVNK 139 Query: 182 EGKVVDRYAPTTGPLRIEKDIQGLLAVS 265 EGKVV+RYAPTT PL+IEKDIQ LL S Sbjct: 140 EGKVVERYAPTTSPLKIEKDIQNLLGAS 167 >ref|NP_001237745.1| uncharacterized protein LOC100527297 [Glycine max] gi|255632031|gb|ACU16368.1| unknown [Glycine max] Length = 199 Score = 139 bits (349), Expect = 3e-31 Identities = 63/84 (75%), Positives = 77/84 (91%) Frame = +2 Query: 5 HDEIKEVARSKFKAEFPVFAKIDVNGKDAAPLYQFLKSQKGGLFGNAIKWNFTKFLVNKE 184 ++EI+EV ++FKAEFP+F K++VNGK+AAPLY+FLK QKGG+FG+ IKWNFTKFLVNKE Sbjct: 114 NEEIREVVCTRFKAEFPIFDKVEVNGKNAAPLYKFLKEQKGGIFGDGIKWNFTKFLVNKE 173 Query: 185 GKVVDRYAPTTGPLRIEKDIQGLL 256 GKVVDRYAPTT PL+IEKDI+ LL Sbjct: 174 GKVVDRYAPTTSPLKIEKDIEKLL 197 >gb|AEG64804.1| putative glutathione peroxidase [Jatropha curcas] Length = 167 Score = 136 bits (342), Expect = 2e-30 Identities = 63/86 (73%), Positives = 77/86 (89%) Frame = +2 Query: 8 DEIKEVARSKFKAEFPVFAKIDVNGKDAAPLYQFLKSQKGGLFGNAIKWNFTKFLVNKEG 187 D+I+E A + FKAEFP+F KI+VNGK++APLY++LKS+KGG+FG+AIKWNFTKFLVNKEG Sbjct: 82 DKIQETACTLFKAEFPIFDKIEVNGKNSAPLYKYLKSEKGGIFGDAIKWNFTKFLVNKEG 141 Query: 188 KVVDRYAPTTGPLRIEKDIQGLLAVS 265 K V+RYAPTT PL+IEKDIQ LL S Sbjct: 142 KTVERYAPTTSPLKIEKDIQNLLGSS 167 >ref|NP_001237193.1| uncharacterized protein LOC100306590 [Glycine max] gi|255628997|gb|ACU14843.1| unknown [Glycine max] Length = 166 Score = 135 bits (340), Expect = 3e-30 Identities = 61/84 (72%), Positives = 76/84 (90%) Frame = +2 Query: 5 HDEIKEVARSKFKAEFPVFAKIDVNGKDAAPLYQFLKSQKGGLFGNAIKWNFTKFLVNKE 184 ++EI+EV ++FKAEFP+F K++VNGK+A PLY+FLK +KGG+FG+ IKWNFTKFLVNKE Sbjct: 81 NEEIQEVVCTRFKAEFPIFDKVEVNGKNAVPLYKFLKEKKGGIFGDGIKWNFTKFLVNKE 140 Query: 185 GKVVDRYAPTTGPLRIEKDIQGLL 256 GKVVDRYAPTT PL+IEKDI+ LL Sbjct: 141 GKVVDRYAPTTSPLKIEKDIEKLL 164 >ref|XP_002489307.1| hypothetical protein SORBIDRAFT_0010s007790 [Sorghum bicolor] gi|241946955|gb|EES20100.1| hypothetical protein SORBIDRAFT_0010s007790 [Sorghum bicolor] Length = 205 Score = 135 bits (340), Expect = 3e-30 Identities = 62/89 (69%), Positives = 77/89 (86%) Frame = +2 Query: 2 THDEIKEVARSKFKAEFPVFAKIDVNGKDAAPLYQFLKSQKGGLFGNAIKWNFTKFLVNK 181 T+++I+E S+FKAEFP+F KIDVNGKDAAPLY++LKSQKGG G+ IKWNFTKFLV+K Sbjct: 117 TNEDIQETVCSRFKAEFPIFDKIDVNGKDAAPLYKYLKSQKGGFLGDGIKWNFTKFLVDK 176 Query: 182 EGKVVDRYAPTTGPLRIEKDIQGLLAVST 268 +GKVV+RYAPTT PL+IE DIQ LL ++ Sbjct: 177 DGKVVERYAPTTSPLKIENDIQKLLGTAS 205