BLASTX nr result
ID: Papaver22_contig00014270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00014270 (566 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532555.1| conserved hypothetical protein [Ricinus comm... 59 7e-07 >ref|XP_002532555.1| conserved hypothetical protein [Ricinus communis] gi|223527710|gb|EEF29816.1| conserved hypothetical protein [Ricinus communis] Length = 690 Score = 58.5 bits (140), Expect = 7e-07 Identities = 41/146 (28%), Positives = 69/146 (47%), Gaps = 4/146 (2%) Frame = -3 Query: 507 VVVLRLDFSKKEWKEVTCLGDNVLFISEHTRACCSASKLGLTSGCLYYTLRKDQGLYKFE 328 + V ++DFS+ W++V C+ D+VLF+ +H C + + LY+ L KD LY + Sbjct: 237 IEVRKIDFSRMAWEKVECVKDSVLFLDDHYSISCPEIRPEIQGNRLYFVL-KDHKLYSYS 295 Query: 327 VQSSGNSVILPCLMLPKTWFPSDWIM----IIDGRQQEEEEEDCTGKAVESDSSIVAYEK 160 ++ S++ P LP+ F S W+M G + EE + C EK Sbjct: 296 IEDRSISLVSP--YLPEDPFLSFWVMPDLRDYAGSRNREEIDACG-------------EK 340 Query: 159 NEKEKEGRFEETSPLDFLKAVILRCL 82 E +E F P D + ++I++ L Sbjct: 341 QEIHQEAYFHRL-PSDVITSLIIKRL 365