BLASTX nr result
ID: Papaver22_contig00014144
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00014144 (487 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534572.1| Male sterility protein, putative [Ricinus co... 44 5e-06 >ref|XP_002534572.1| Male sterility protein, putative [Ricinus communis] gi|223524996|gb|EEF27810.1| Male sterility protein, putative [Ricinus communis] Length = 387 Score = 43.5 bits (101), Expect(2) = 5e-06 Identities = 31/93 (33%), Positives = 46/93 (49%), Gaps = 6/93 (6%) Frame = -3 Query: 311 RYDVAMNINTRGPF*LMTL*KGSRNFNCSCKYQLTKTR*N-----LGKTIFYRDSLAREQ 147 RYDVA++INTRG LM K +N + + KT D +A+E Sbjct: 229 RYDVAVDINTRGACHLMNFAKKCQNLKLFLQVSTAYVNGQRQGRIMEKTFCIGDCIAKEN 288 Query: 146 -LASNTHARAPPLIYIEAEMKLASHSKKTFQEN 51 ++ +T P++ +E EMKLA +SK QE+ Sbjct: 289 FISESTSGSLLPILDVEYEMKLALNSKDGLQES 321 Score = 31.6 bits (70), Expect(2) = 5e-06 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 45 LGFERERTYGWQDTY 1 LG ER R YGWQDTY Sbjct: 330 LGLERARRYGWQDTY 344