BLASTX nr result
ID: Papaver22_contig00013749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00013749 (586 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15429.3| unnamed protein product [Vitis vinifera] 102 5e-20 ref|XP_002275254.1| PREDICTED: peptidyl-tRNA hydrolase, chloropl... 102 5e-20 ref|XP_002511963.1| peptidyl-tRNA hydrolase, putative [Ricinus c... 102 6e-20 ref|XP_004157420.1| PREDICTED: peptidyl-tRNA hydrolase, chloropl... 100 2e-19 ref|XP_004137468.1| PREDICTED: peptidyl-tRNA hydrolase, chloropl... 100 2e-19 >emb|CBI15429.3| unnamed protein product [Vitis vinifera] Length = 307 Score = 102 bits (254), Expect = 5e-20 Identities = 49/58 (84%), Positives = 54/58 (93%) Frame = -3 Query: 584 KGSRDFPRLRIGIGRPTGKMDGASFVLRPFNKQEREELDFTFQNGYEALRILLLEGFD 411 KGSRDFPRLRIGIGRP GKMD A+FVL PF+K+EREELDFTFQNG EA+RILLLEGF+ Sbjct: 233 KGSRDFPRLRIGIGRPPGKMDTANFVLSPFSKREREELDFTFQNGVEAVRILLLEGFN 290 >ref|XP_002275254.1| PREDICTED: peptidyl-tRNA hydrolase, chloroplastic-like [Vitis vinifera] Length = 205 Score = 102 bits (254), Expect = 5e-20 Identities = 49/58 (84%), Positives = 54/58 (93%) Frame = -3 Query: 584 KGSRDFPRLRIGIGRPTGKMDGASFVLRPFNKQEREELDFTFQNGYEALRILLLEGFD 411 KGSRDFPRLRIGIGRP GKMD A+FVL PF+K+EREELDFTFQNG EA+RILLLEGF+ Sbjct: 131 KGSRDFPRLRIGIGRPPGKMDTANFVLSPFSKREREELDFTFQNGVEAVRILLLEGFN 188 >ref|XP_002511963.1| peptidyl-tRNA hydrolase, putative [Ricinus communis] gi|223549143|gb|EEF50632.1| peptidyl-tRNA hydrolase, putative [Ricinus communis] Length = 272 Score = 102 bits (253), Expect = 6e-20 Identities = 48/58 (82%), Positives = 53/58 (91%) Frame = -3 Query: 584 KGSRDFPRLRIGIGRPTGKMDGASFVLRPFNKQEREELDFTFQNGYEALRILLLEGFD 411 KGSRDFPRLRIGIGRP GKMD A+FVLRPF++QE EELDFTFQ G EA+RILLLEGF+ Sbjct: 199 KGSRDFPRLRIGIGRPPGKMDSANFVLRPFSRQEHEELDFTFQQGLEAIRILLLEGFN 256 >ref|XP_004157420.1| PREDICTED: peptidyl-tRNA hydrolase, chloroplastic-like [Cucumis sativus] Length = 273 Score = 100 bits (248), Expect = 2e-19 Identities = 48/58 (82%), Positives = 53/58 (91%) Frame = -3 Query: 584 KGSRDFPRLRIGIGRPTGKMDGASFVLRPFNKQEREELDFTFQNGYEALRILLLEGFD 411 KGSRDFPRLRIGIGRP GKMD A+FVLRPFNKQEREEL+FT Q G +A+RILLLEGF+ Sbjct: 200 KGSRDFPRLRIGIGRPPGKMDAANFVLRPFNKQEREELNFTLQVGEDAIRILLLEGFN 257 >ref|XP_004137468.1| PREDICTED: peptidyl-tRNA hydrolase, chloroplastic-like [Cucumis sativus] Length = 274 Score = 100 bits (248), Expect = 2e-19 Identities = 48/58 (82%), Positives = 53/58 (91%) Frame = -3 Query: 584 KGSRDFPRLRIGIGRPTGKMDGASFVLRPFNKQEREELDFTFQNGYEALRILLLEGFD 411 KGSRDFPRLRIGIGRP GKMD A+FVLRPFNKQEREEL+FT Q G +A+RILLLEGF+ Sbjct: 201 KGSRDFPRLRIGIGRPPGKMDAANFVLRPFNKQEREELNFTLQVGEDAIRILLLEGFN 258