BLASTX nr result
ID: Papaver22_contig00013213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00013213 (595 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525675.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 >ref|XP_002525675.1| conserved hypothetical protein [Ricinus communis] gi|223534975|gb|EEF36658.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 57.8 bits (138), Expect = 1e-06 Identities = 36/84 (42%), Positives = 51/84 (60%), Gaps = 1/84 (1%) Frame = +3 Query: 141 GFFYVFSLVTATPLSRSLKLDAEDYSSTNRE-LVMQGFMEETGNYEQVVLKGEEEGFLIH 317 GF ++ S + A P +RSLK ++ SS+ ++ L+ Q M+ + +GEE F+I Sbjct: 16 GFSFLLSSL-AVPTTRSLKSTEDNPSSSVQDFLIHQEGMDLSS-------QGEELDFIIA 67 Query: 318 GRMVAESVDYPGAGANKNHDPKPP 389 GRM ES DYPG GAN +HDPK P Sbjct: 68 GRMDLESTDYPGTGANNHHDPKTP 91