BLASTX nr result
ID: Papaver22_contig00012947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00012947 (427 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523320.1| nucleotide binding protein, putative [Ricinu... 58 9e-07 ref|XP_002264136.2| PREDICTED: uncharacterized protein LOC100255... 57 1e-06 emb|CBI40569.3| unnamed protein product [Vitis vinifera] 57 1e-06 ref|NP_182179.3| transducin family protein / WD-40 repeat family... 57 2e-06 ref|XP_002882076.1| transducin family protein [Arabidopsis lyrat... 57 2e-06 >ref|XP_002523320.1| nucleotide binding protein, putative [Ricinus communis] gi|223537408|gb|EEF39036.1| nucleotide binding protein, putative [Ricinus communis] Length = 2299 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = +1 Query: 142 RLLFLKERVPKDSALMYIALNRLQVLDELFKVSKDETDKQLV 267 R+ +L+ R PKD AL+Y+ALNR+QVL LFK+SKDE DK LV Sbjct: 1243 RMQYLRNRDPKDCALLYVALNRIQVLAGLFKISKDEKDKPLV 1284 >ref|XP_002264136.2| PREDICTED: uncharacterized protein LOC100255258 [Vitis vinifera] Length = 2572 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +1 Query: 142 RLLFLKERVPKDSALMYIALNRLQVLDELFKVSKDETDKQLV 267 RL +LK + PKD +L+YIALNRL+VL LFK+SKDE DK LV Sbjct: 1296 RLQYLKNKDPKDCSLLYIALNRLKVLTGLFKISKDEKDKPLV 1337 >emb|CBI40569.3| unnamed protein product [Vitis vinifera] Length = 2065 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +1 Query: 142 RLLFLKERVPKDSALMYIALNRLQVLDELFKVSKDETDKQLV 267 RL +LK + PKD +L+YIALNRL+VL LFK+SKDE DK LV Sbjct: 952 RLQYLKNKDPKDCSLLYIALNRLKVLTGLFKISKDEKDKPLV 993 >ref|NP_182179.3| transducin family protein / WD-40 repeat family protein [Arabidopsis thaliana] gi|330255627|gb|AEC10721.1| transducin family protein / WD-40 repeat family protein [Arabidopsis thaliana] Length = 2513 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +1 Query: 142 RLLFLKERVPKDSALMYIALNRLQVLDELFKVSKDETDKQLVV 270 R +LK + PKD AL+YIALNR+QVL LFK+SKDE DK LVV Sbjct: 1256 RQQYLKNKNPKDCALLYIALNRVQVLAGLFKLSKDEKDKPLVV 1298 >ref|XP_002882076.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] gi|297327915|gb|EFH58335.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] Length = 2458 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +1 Query: 142 RLLFLKERVPKDSALMYIALNRLQVLDELFKVSKDETDKQLVV 270 R +LK + PKD AL+YIALNR+QVL LFK+SKDE DK LVV Sbjct: 1249 RQQYLKNKNPKDCALLYIALNRVQVLAGLFKLSKDEKDKPLVV 1291