BLASTX nr result
ID: Papaver22_contig00011901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00011901 (650 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514114.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002514114.1| conserved hypothetical protein [Ricinus communis] gi|223546570|gb|EEF48068.1| conserved hypothetical protein [Ricinus communis] Length = 1282 Score = 57.4 bits (137), Expect = 2e-06 Identities = 37/107 (34%), Positives = 54/107 (50%), Gaps = 5/107 (4%) Frame = +2 Query: 74 VGFLLFMIIFQAHESTGYRISRSLDISSFRPASEEN-----SPNKFSILSSLTSPTGSAI 238 V F++ I+F H STGY IS S I S +E P ++L S++ P G + Sbjct: 12 VKFVVIGIVFILHGSTGYHISPSPAIFSETAPTEGTLTPFEKPLTSNVLGSVSQPNGLHL 71 Query: 239 PPDVASQPHTSAPISQPFEGILPSTAPSPPSDVPSLNSPPLPQVIQG 379 P +A P S P+ Q F+G++PS +PS P N+ P P +G Sbjct: 72 HPPLALPPPMSTPLPQEFKGLVPSHSPSSPVARLLHNTAPPPLNFEG 118