BLASTX nr result
ID: Papaver22_contig00011428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00011428 (437 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD10675.1| Similar to human BC-2 protein [Arabidopsis thaliana] 81 1e-13 ref|NP_563696.1| vacuolar protein sorting-associated protein 2.3... 81 1e-13 ref|XP_002307657.1| predicted protein [Populus trichocarpa] gi|2... 79 3e-13 ref|XP_004150360.1| PREDICTED: vacuolar protein sorting-associat... 78 6e-13 ref|XP_002892189.1| SNF7 family protein [Arabidopsis lyrata subs... 77 1e-12 >gb|AAD10675.1| Similar to human BC-2 protein [Arabidopsis thaliana] Length = 213 Score = 80.9 bits (198), Expect = 1e-13 Identities = 42/52 (80%), Positives = 46/52 (88%) Frame = +3 Query: 3 EDLTNQVLDEIGVDIASQLSTAPKGRIAGKKYEDASSSSVDDELEKRLAALR 158 EDLTNQVLDEIG+DIASQLS+APKG+I GKK ED SS + DELEKRLAALR Sbjct: 163 EDLTNQVLDEIGIDIASQLSSAPKGKIGGKKAEDVGSSGI-DELEKRLAALR 213 >ref|NP_563696.1| vacuolar protein sorting-associated protein 2.3 [Arabidopsis thaliana] gi|75249519|sp|Q941D5.1|VPS2C_ARATH RecName: Full=Vacuolar protein sorting-associated protein 2 homolog 3; Short=AtVPS2-3; AltName: Full=Charged multivesicular body protein 2 homolog 3; AltName: Full=ESCRT-III complex subunit VPS2 homolog 3 gi|15529228|gb|AAK97708.1| At1g03950/F21M11_12 [Arabidopsis thaliana] gi|16974377|gb|AAL31114.1| At1g03950/F21M11_12 [Arabidopsis thaliana] gi|332189516|gb|AEE27637.1| vacuolar protein sorting-associated protein 2.3 [Arabidopsis thaliana] Length = 210 Score = 80.9 bits (198), Expect = 1e-13 Identities = 42/52 (80%), Positives = 46/52 (88%) Frame = +3 Query: 3 EDLTNQVLDEIGVDIASQLSTAPKGRIAGKKYEDASSSSVDDELEKRLAALR 158 EDLTNQVLDEIG+DIASQLS+APKG+I GKK ED SS + DELEKRLAALR Sbjct: 160 EDLTNQVLDEIGIDIASQLSSAPKGKIGGKKAEDVGSSGI-DELEKRLAALR 210 >ref|XP_002307657.1| predicted protein [Populus trichocarpa] gi|222857106|gb|EEE94653.1| predicted protein [Populus trichocarpa] Length = 212 Score = 79.3 bits (194), Expect = 3e-13 Identities = 41/52 (78%), Positives = 46/52 (88%) Frame = +3 Query: 3 EDLTNQVLDEIGVDIASQLSTAPKGRIAGKKYEDASSSSVDDELEKRLAALR 158 E+LTNQVLDEIGVD+ASQLS APKG+I GK EDASSS + DELEKRLAA+R Sbjct: 160 EELTNQVLDEIGVDVASQLSVAPKGKITGKNREDASSSGI-DELEKRLAAMR 210 >ref|XP_004150360.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 3-like [Cucumis sativus] gi|449513010|ref|XP_004164203.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 3-like [Cucumis sativus] Length = 212 Score = 78.2 bits (191), Expect = 6e-13 Identities = 42/52 (80%), Positives = 44/52 (84%) Frame = +3 Query: 3 EDLTNQVLDEIGVDIASQLSTAPKGRIAGKKYEDASSSSVDDELEKRLAALR 158 EDLTNQVLDEIGVD+ASQLSTAPKGRIA K E SS + DELEKRLAALR Sbjct: 160 EDLTNQVLDEIGVDVASQLSTAPKGRIASKNTEGVGSSGI-DELEKRLAALR 210 >ref|XP_002892189.1| SNF7 family protein [Arabidopsis lyrata subsp. lyrata] gi|297338031|gb|EFH68448.1| SNF7 family protein [Arabidopsis lyrata subsp. lyrata] Length = 210 Score = 77.0 bits (188), Expect = 1e-12 Identities = 40/52 (76%), Positives = 45/52 (86%) Frame = +3 Query: 3 EDLTNQVLDEIGVDIASQLSTAPKGRIAGKKYEDASSSSVDDELEKRLAALR 158 EDLTNQVLDEIG+DIASQLS+APKG+I GK E+ SS + DELEKRLAALR Sbjct: 160 EDLTNQVLDEIGIDIASQLSSAPKGKIGGKNAENVGSSEI-DELEKRLAALR 210