BLASTX nr result
ID: Papaver22_contig00011164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00011164 (407 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308410.1| stress-induced hydrophobic peptide [Populus ... 100 2e-19 gb|ABK93775.1| unknown [Populus trichocarpa] 100 2e-19 ref|NP_194795.1| putative low temperature and salt responsive pr... 99 3e-19 gb|ADR71296.1| stress-induced hydrophobic peptide 1 [Hevea brasi... 99 3e-19 dbj|BAH19935.1| AT4G30660 [Arabidopsis thaliana] 99 3e-19 >ref|XP_002308410.1| stress-induced hydrophobic peptide [Populus trichocarpa] gi|222854386|gb|EEE91933.1| stress-induced hydrophobic peptide [Populus trichocarpa] Length = 73 Score = 99.8 bits (247), Expect = 2e-19 Identities = 46/68 (67%), Positives = 55/68 (80%) Frame = -3 Query: 360 CCDILIAILLPPLGVCFKTGCCSMEFLICILLTILGYIPGIIYAVYIIAIQDRSELGGER 181 CC+ILIAILLPPLGVCF+ GCCS+EF IC+LLTILGY+PGIIYA+Y I DR+E Sbjct: 8 CCEILIAILLPPLGVCFRHGCCSVEFCICLLLTILGYVPGIIYALYAIVFIDRNEY---- 63 Query: 180 SDDLRRPI 157 D+ RRP+ Sbjct: 64 FDEYRRPL 71 >gb|ABK93775.1| unknown [Populus trichocarpa] Length = 75 Score = 99.8 bits (247), Expect = 2e-19 Identities = 46/68 (67%), Positives = 55/68 (80%) Frame = -3 Query: 360 CCDILIAILLPPLGVCFKTGCCSMEFLICILLTILGYIPGIIYAVYIIAIQDRSELGGER 181 CC+ILIAILLPPLGVCF+ GCCS+EF IC+LLTILGY+PGIIYA+Y I DR+E Sbjct: 8 CCEILIAILLPPLGVCFRHGCCSVEFCICLLLTILGYVPGIIYALYAIVFIDRNEY---- 63 Query: 180 SDDLRRPI 157 D+ RRP+ Sbjct: 64 FDEYRRPL 71 >ref|NP_194795.1| putative low temperature and salt responsive protein [Arabidopsis thaliana] gi|238481000|ref|NP_001154278.1| putative low temperature and salt responsive protein [Arabidopsis thaliana] gi|15214237|sp|Q9SUI0.1|RC24_ARATH RecName: Full=UPF0057 membrane protein At4g30660 gi|5725430|emb|CAB52439.1| stress responsive protein homolog [Arabidopsis thaliana] gi|7269967|emb|CAB79784.1| stress responsive protein homolog [Arabidopsis thaliana] gi|119360113|gb|ABL66785.1| At4g30660 [Arabidopsis thaliana] gi|332660391|gb|AEE85791.1| putative low temperature and salt responsive protein [Arabidopsis thaliana] gi|332660392|gb|AEE85792.1| putative low temperature and salt responsive protein [Arabidopsis thaliana] Length = 74 Score = 99.4 bits (246), Expect = 3e-19 Identities = 45/70 (64%), Positives = 56/70 (80%) Frame = -3 Query: 357 CDILIAILLPPLGVCFKTGCCSMEFLICILLTILGYIPGIIYAVYIIAIQDRSELGGERS 178 C+I+IAILLPPLGVCF+ GCC++EFLIC++LTILGY+PGIIYA+Y+I Q R E Sbjct: 9 CEIIIAILLPPLGVCFRKGCCTVEFLICLVLTILGYVPGIIYAIYVIVFQHREEY----F 64 Query: 177 DDLRRPISDA 148 D+ RRPI A Sbjct: 65 DEYRRPIYSA 74 >gb|ADR71296.1| stress-induced hydrophobic peptide 1 [Hevea brasiliensis] Length = 75 Score = 99.4 bits (246), Expect = 3e-19 Identities = 46/68 (67%), Positives = 54/68 (79%) Frame = -3 Query: 360 CCDILIAILLPPLGVCFKTGCCSMEFLICILLTILGYIPGIIYAVYIIAIQDRSELGGER 181 CC+ILIAILLPPLGVCF+ GCCS+EF IC+LLTILGY+PGIIYA+Y I DR E Sbjct: 8 CCEILIAILLPPLGVCFRHGCCSVEFCICLLLTILGYVPGIIYALYAIVFVDRDEY---- 63 Query: 180 SDDLRRPI 157 D+ RRP+ Sbjct: 64 FDESRRPL 71 >dbj|BAH19935.1| AT4G30660 [Arabidopsis thaliana] Length = 74 Score = 99.4 bits (246), Expect = 3e-19 Identities = 45/70 (64%), Positives = 56/70 (80%) Frame = -3 Query: 357 CDILIAILLPPLGVCFKTGCCSMEFLICILLTILGYIPGIIYAVYIIAIQDRSELGGERS 178 C+I+IAILLPPLGVCF+ GCC++EFLIC++LTILGY+PGIIYA+Y+I Q R E Sbjct: 9 CEIIIAILLPPLGVCFRKGCCTVEFLICLVLTILGYVPGIIYAIYVIVFQHREEY----F 64 Query: 177 DDLRRPISDA 148 D+ RRPI A Sbjct: 65 DEYRRPIYSA 74