BLASTX nr result
ID: Papaver22_contig00011062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00011062 (422 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528199.1| Heat shock 70 kDa protein, putative [Ricinus... 55 8e-06 >ref|XP_002528199.1| Heat shock 70 kDa protein, putative [Ricinus communis] gi|223532411|gb|EEF34206.1| Heat shock 70 kDa protein, putative [Ricinus communis] Length = 849 Score = 54.7 bits (130), Expect = 8e-06 Identities = 38/94 (40%), Positives = 48/94 (51%), Gaps = 19/94 (20%) Frame = -2 Query: 421 VHESFLMPIALYWKGSSPDS------NAES*V-------------LDFI*VRNIHN*CSV 299 V+ESF IAL WKG++PD+ N +S + L F Sbjct: 391 VNESFPFSIALSWKGAAPDAQSGAADNQQSTIVFPKGNPIPSVKALTFYRSGTFTVDVQY 450 Query: 298 C*EAELQVPVRISMYTIGPFQSKNGERSKLKVKS 197 +ELQVP RIS YTIGPFQS ER+K+KVK+ Sbjct: 451 ADVSELQVPARISTYTIGPFQSSTSERAKVKVKA 484