BLASTX nr result
ID: Papaver22_contig00011013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00011013 (490 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI39675.3| unnamed protein product [Vitis vinifera] 55 5e-06 ref|XP_002329990.1| stress-induced hydrophobic peptide [Populus ... 55 8e-06 >emb|CBI39675.3| unnamed protein product [Vitis vinifera] Length = 113 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/65 (46%), Positives = 38/65 (58%) Frame = -2 Query: 432 LSRREKKNGRRINFELHRHLVGYHPSSSWCLSQVRMPD*VLDLSYLDILRLHSWYHLRHL 253 +++ ++NG LHRH +G+H + WCL QV MP VLDL D RL SW L L Sbjct: 36 VTKTREENGSH----LHRHSLGHHLAPPWCLPQVWMPGGVLDLFGADFFRLPSWNCLCCL 91 Query: 252 RHHQV 238 HHQV Sbjct: 92 CHHQV 96 >ref|XP_002329990.1| stress-induced hydrophobic peptide [Populus trichocarpa] gi|222871415|gb|EEF08546.1| stress-induced hydrophobic peptide [Populus trichocarpa] Length = 57 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = -3 Query: 410 MADESTLNCXXXXXXXXXXXLGVFLKFGCQIEFWICLILTFF 285 MADE T C LGVFLKFGC +EFWICL+LTFF Sbjct: 1 MADEGTATCIDILLAIILPPLGVFLKFGCGVEFWICLLLTFF 42