BLASTX nr result
ID: Papaver22_contig00010331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00010331 (444 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003529796.1| PREDICTED: putative F-box/FBD/LRR-repeat pro... 39 8e-06 >ref|XP_003529796.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78840-like [Glycine max] Length = 449 Score = 38.9 bits (89), Expect(2) = 8e-06 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -1 Query: 129 FIPGHEIVQTSILSRKWRYMWTSVSTLVFDSSVF 28 F+ + +QT +LS++WRY+W SV L F S F Sbjct: 72 FMETKDAIQTCVLSKRWRYLWASVPCLSFSSKSF 105 Score = 35.4 bits (80), Expect(2) = 8e-06 Identities = 18/52 (34%), Positives = 30/52 (57%) Frame = -2 Query: 266 SGESLHSKV*NLISSSIHMEEIRNVPFSNNQDRISNLSESLIHHILSFPDMK 111 SG +L +++S + + N +QDR+S++ + LIHHILSF + K Sbjct: 29 SGPALKKSKTKILAS----QNVDNCEMEESQDRLSDMPDCLIHHILSFMETK 76