BLASTX nr result
ID: Papaver22_contig00009948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00009948 (456 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306126.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 ref|XP_002512962.1| Purple acid phosphatase precursor, putative ... 66 3e-09 ref|XP_002264224.1| PREDICTED: purple acid phosphatase 2 isoform... 65 4e-09 ref|XP_002264113.1| PREDICTED: purple acid phosphatase 2 isoform... 65 4e-09 gb|AAX20028.1| purple acid phosphatase [Medicago truncatula] 65 6e-09 >ref|XP_002306126.1| predicted protein [Populus trichocarpa] gi|222849090|gb|EEE86637.1| predicted protein [Populus trichocarpa] Length = 468 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -3 Query: 127 LFVTLFLIFNVAVICNGGITSKFVRKVEKTIDMPLDSDVFSV 2 +F LFL+FN AV+C+GG TS FVRKVEKTIDMPLDSDVF V Sbjct: 11 VFAVLFLVFNAAVLCHGGKTSSFVRKVEKTIDMPLDSDVFKV 52 >ref|XP_002512962.1| Purple acid phosphatase precursor, putative [Ricinus communis] gi|223547973|gb|EEF49465.1| Purple acid phosphatase precursor, putative [Ricinus communis] Length = 467 Score = 65.9 bits (159), Expect = 3e-09 Identities = 32/43 (74%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -3 Query: 127 LFVTLF-LIFNVAVICNGGITSKFVRKVEKTIDMPLDSDVFSV 2 LF+ LF L+ NVAV+CNGG TS FVR VEKT+DMPLDSDVF V Sbjct: 9 LFIVLFGLVLNVAVLCNGGKTSSFVRPVEKTVDMPLDSDVFQV 51 >ref|XP_002264224.1| PREDICTED: purple acid phosphatase 2 isoform 3 [Vitis vinifera] Length = 447 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 130 SLFVTLFLIFNVAVICNGGITSKFVRKVEKTIDMPLDSDVFSV 2 ++ + L L+ N AV+C+GGITS FVRKVEKTIDMPLDSDVF V Sbjct: 14 TVVIVLGLVLNAAVVCHGGITSSFVRKVEKTIDMPLDSDVFRV 56 >ref|XP_002264113.1| PREDICTED: purple acid phosphatase 2 isoform 1 [Vitis vinifera] Length = 472 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 130 SLFVTLFLIFNVAVICNGGITSKFVRKVEKTIDMPLDSDVFSV 2 ++ + L L+ N AV+C+GGITS FVRKVEKTIDMPLDSDVF V Sbjct: 14 TVVIVLGLVLNAAVVCHGGITSSFVRKVEKTIDMPLDSDVFRV 56 >gb|AAX20028.1| purple acid phosphatase [Medicago truncatula] Length = 465 Score = 65.1 bits (157), Expect = 6e-09 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -3 Query: 136 LFSLFVTLFLIFNVAVICNGGITSKFVRKVEKTIDMPLDSDVFSV 2 L SL + L L+ N+ +CNGG TS FVRKVEKTIDMPLDSDVF V Sbjct: 4 LHSLLLALCLVLNLVFVCNGGRTSTFVRKVEKTIDMPLDSDVFDV 48