BLASTX nr result
ID: Papaver22_contig00009765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00009765 (595 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_187239.1| Hydrophobic protein RCI2A [Arabidopsis thaliana... 100 2e-19 gb|AFK81273.1| rare cold-inducible protein 2A [Camelina sativa] ... 100 2e-19 gb|AAF26091.1|AC012393_17 low temperature and salt responsive pr... 99 5e-19 ref|XP_002884539.1| low temperature and salt responsive protein ... 99 5e-19 gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK4930... 98 1e-18 >ref|NP_187239.1| Hydrophobic protein RCI2A [Arabidopsis thaliana] gi|15214251|sp|Q9ZNQ7.1|RCI2A_ARATH RecName: Full=Hydrophobic protein RCI2A; AltName: Full=Low temperature and salt-responsive protein LTI6A gi|6714401|gb|AAF26090.1|AC012393_16 low temperature and salt responsive protein LTI6A [Arabidopsis thaliana] gi|13957674|gb|AAK50619.1|AF264749_2 hydrophobic protein RCI2A [Arabidopsis thaliana] gi|4039153|gb|AAC97512.1| low temperature and salt responsive protein LTI6A [Arabidopsis thaliana] gi|4325217|gb|AAD17302.1| hydrophobic protein [Arabidopsis thaliana] gi|14335130|gb|AAK59845.1| AT3g05880/F10A16_18 [Arabidopsis thaliana] gi|14532470|gb|AAK63963.1| AT3g05880/F10A16_18 [Arabidopsis thaliana] gi|18655345|gb|AAL76128.1| AT3g05880/F10A16_18 [Arabidopsis thaliana] gi|332640790|gb|AEE74311.1| Hydrophobic protein RCI2A [Arabidopsis thaliana] Length = 54 Score = 100 bits (249), Expect = 2e-19 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = +3 Query: 141 MSTATLVEIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYIPGIIYAIFVLTK 302 MSTAT V+II+AI+LPPLGVFLRFGC VEFWICLVLT LGYIPGIIYAI+VLTK Sbjct: 1 MSTATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54 >gb|AFK81273.1| rare cold-inducible protein 2A [Camelina sativa] gi|388893090|gb|AFK81275.1| rare cold-inducible protein 2A [Camelina sativa] Length = 54 Score = 100 bits (248), Expect = 2e-19 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = +3 Query: 141 MSTATLVEIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYIPGIIYAIFVLTK 302 MSTAT V+II+A++LPPLGVFLRFGC VEFWICLVLT LGYIPGIIYAI+VLTK Sbjct: 1 MSTATFVDIIIAVLLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54 >gb|AAF26091.1|AC012393_17 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] Length = 67 Score = 99.0 bits (245), Expect = 5e-19 Identities = 44/59 (74%), Positives = 53/59 (89%) Frame = +3 Query: 141 MSTATLVEIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYIPGIIYAIFVLTK***CF 317 MSTAT VEIILAIILPPLGVFL+FGC+VEFWICL+LT GY+PGI+YA++++TK CF Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITKKNSCF 59 >ref|XP_002884539.1| low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] gi|297330379|gb|EFH60798.1| low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] Length = 67 Score = 99.0 bits (245), Expect = 5e-19 Identities = 44/59 (74%), Positives = 53/59 (89%) Frame = +3 Query: 141 MSTATLVEIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYIPGIIYAIFVLTK***CF 317 MSTAT VEIILAIILPPLGVFL+FGC+VEFWICL+LT GY+PGI+YA++++TK CF Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITKRNRCF 59 >gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK49304.1| unknown [Lotus japonicus] Length = 54 Score = 97.8 bits (242), Expect = 1e-18 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = +3 Query: 141 MSTATLVEIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYIPGIIYAIFVLTK 302 M TAT V+IILAIILPPLGVFLRFGC+VEFWICL+LT LGYIPGIIYAI+ +TK Sbjct: 1 MGTATCVDIILAIILPPLGVFLRFGCKVEFWICLLLTILGYIPGIIYAIYAITK 54