BLASTX nr result
ID: Papaver22_contig00009550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00009550 (452 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002466588.1| hypothetical protein SORBIDRAFT_01g010430 [S... 72 5e-11 emb|CBI15430.3| unnamed protein product [Vitis vinifera] 71 8e-11 ref|XP_002275327.1| PREDICTED: protein CASP [Vitis vinifera] 71 8e-11 ref|XP_003630836.1| Protein CASP [Medicago truncatula] gi|355524... 70 1e-10 gb|AFW67849.1| hypothetical protein ZEAMMB73_135148 [Zea mays] 70 2e-10 >ref|XP_002466588.1| hypothetical protein SORBIDRAFT_01g010430 [Sorghum bicolor] gi|241920442|gb|EER93586.1| hypothetical protein SORBIDRAFT_01g010430 [Sorghum bicolor] Length = 700 Score = 72.0 bits (175), Expect = 5e-11 Identities = 35/45 (77%), Positives = 39/45 (86%), Gaps = 1/45 (2%) Frame = -1 Query: 452 GRFLLGNRYARTFVFFYSIGLHLLVFACLYRMSAISDLRTSA-HD 321 GRFLLGN+YARTF+FFYSIGLHLLVF LYRMSA+S L T+ HD Sbjct: 641 GRFLLGNKYARTFIFFYSIGLHLLVFTLLYRMSALSYLNTTTQHD 685 >emb|CBI15430.3| unnamed protein product [Vitis vinifera] Length = 671 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 452 GRFLLGNRYARTFVFFYSIGLHLLVFACLYRMSAISDL 339 GRFLLGNRYARTF FFY+IGLH+LVF CLYRMSA+S L Sbjct: 614 GRFLLGNRYARTFAFFYTIGLHVLVFTCLYRMSALSHL 651 >ref|XP_002275327.1| PREDICTED: protein CASP [Vitis vinifera] Length = 684 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 452 GRFLLGNRYARTFVFFYSIGLHLLVFACLYRMSAISDL 339 GRFLLGNRYARTF FFY+IGLH+LVF CLYRMSA+S L Sbjct: 627 GRFLLGNRYARTFAFFYTIGLHVLVFTCLYRMSALSHL 664 >ref|XP_003630836.1| Protein CASP [Medicago truncatula] gi|355524858|gb|AET05312.1| Protein CASP [Medicago truncatula] Length = 683 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = -1 Query: 452 GRFLLGNRYARTFVFFYSIGLHLLVFACLYRMSAISDLRTSAHD*FSSIRT 300 GRFLLGN+YARTF FFY+IGLH+LVF CLYRMSA+S L + + + RT Sbjct: 626 GRFLLGNKYARTFAFFYTIGLHVLVFTCLYRMSALSYLSHGSDETLAGERT 676 >gb|AFW67849.1| hypothetical protein ZEAMMB73_135148 [Zea mays] Length = 700 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -1 Query: 452 GRFLLGNRYARTFVFFYSIGLHLLVFACLYRMSAISDLRTS 330 GRF+LGN+YARTF+FFYSIGLHLLVF LYRMSA+S L T+ Sbjct: 641 GRFVLGNKYARTFIFFYSIGLHLLVFTLLYRMSALSYLNTT 681