BLASTX nr result
ID: Papaver22_contig00008823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00008823 (452 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514522.1| ATP binding protein, putative [Ricinus commu... 63 3e-08 ref|XP_002277905.1| PREDICTED: proline-rich receptor-like protei... 57 2e-06 >ref|XP_002514522.1| ATP binding protein, putative [Ricinus communis] gi|223546126|gb|EEF47628.1| ATP binding protein, putative [Ricinus communis] Length = 811 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/55 (52%), Positives = 42/55 (76%) Frame = -3 Query: 168 RRQKKRNAGYHGGYVLPSPFDSSPRSDLSLFKSQSPVPLIGSGPSGAATDFTHSP 4 R+++K G +GGYV+PSP SSPR+DL+L K+Q+ +PL+GSG S TD+ +SP Sbjct: 408 RKRRKEAHGLNGGYVMPSPLGSSPRTDLNLSKAQTTIPLMGSGSS---TDYVYSP 459 >ref|XP_002277905.1| PREDICTED: proline-rich receptor-like protein kinase PERK9 [Vitis vinifera] gi|297737910|emb|CBI27111.3| unnamed protein product [Vitis vinifera] Length = 726 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/55 (50%), Positives = 39/55 (70%) Frame = -3 Query: 168 RRQKKRNAGYHGGYVLPSPFDSSPRSDLSLFKSQSPVPLIGSGPSGAATDFTHSP 4 R++KK+ +G +GGYV+P+ SSPRSD S K+ S PLIG SG+ +DF +SP Sbjct: 326 RKRKKKVSGLNGGYVMPATLGSSPRSDSSFTKTLSSAPLIG---SGSGSDFVYSP 377