BLASTX nr result
ID: Papaver22_contig00008716
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00008716 (457 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308992.1| predicted protein [Populus trichocarpa] gi|2... 69 5e-10 ref|XP_002519980.1| Ethanolamine-phosphate cytidylyltransferase,... 68 9e-10 ref|XP_004163014.1| PREDICTED: ethanolamine-phosphate cytidylylt... 66 3e-09 ref|XP_004149674.1| PREDICTED: ethanolamine-phosphate cytidylylt... 66 3e-09 emb|CBI40665.3| unnamed protein product [Vitis vinifera] 65 4e-09 >ref|XP_002308992.1| predicted protein [Populus trichocarpa] gi|222854968|gb|EEE92515.1| predicted protein [Populus trichocarpa] Length = 395 Score = 68.6 bits (166), Expect = 5e-10 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -3 Query: 455 KNITTTSVAKRIIANLEAYKKRNAKKEESEKRYYAGKTFVSGD 327 KNITTTSVA+RI+AN EAY KRNAKK ESEK+YYA K VSGD Sbjct: 353 KNITTTSVAQRIVANHEAYLKRNAKKAESEKKYYAEKVHVSGD 395 >ref|XP_002519980.1| Ethanolamine-phosphate cytidylyltransferase, putative [Ricinus communis] gi|223540744|gb|EEF42304.1| Ethanolamine-phosphate cytidylyltransferase, putative [Ricinus communis] Length = 418 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -3 Query: 452 NITTTSVAKRIIANLEAYKKRNAKKEESEKRYYAGKTFVSGD 327 +ITTT++ +RI+AN EAY+KRN KK ESEKRYY GKTFVSGD Sbjct: 377 DITTTTIIRRIVANHEAYQKRNEKKAESEKRYYEGKTFVSGD 418 >ref|XP_004163014.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis sativus] Length = 423 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -3 Query: 455 KNITTTSVAKRIIANLEAYKKRNAKKEESEKRYYAGKTFVSGD 327 K ITTTS+AKRI+AN +A+KKRNAKK ESEK+YYA K ++ GD Sbjct: 381 KTITTTSIAKRIVANHDAFKKRNAKKVESEKKYYAEKKYICGD 423 >ref|XP_004149674.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis sativus] Length = 116 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -3 Query: 455 KNITTTSVAKRIIANLEAYKKRNAKKEESEKRYYAGKTFVSGD 327 K ITTTS+AKRI+AN +A+KKRNAKK ESEK+YYA K ++ GD Sbjct: 74 KTITTTSIAKRIVANHDAFKKRNAKKVESEKKYYAEKKYICGD 116 >emb|CBI40665.3| unnamed protein product [Vitis vinifera] Length = 362 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -3 Query: 455 KNITTTSVAKRIIANLEAYKKRNAKKEESEKRYYAGKTFVSGD 327 K+ITTTSVA+RIIAN EAY KRN KK ESEK+YYA K +VSG+ Sbjct: 320 KDITTTSVAQRIIANHEAYMKRNVKKAESEKKYYAEKKYVSGE 362