BLASTX nr result
ID: Papaver22_contig00007279
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00007279 (585 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516284.1| conserved hypothetical protein [Ricinus comm... 70 3e-10 ref|XP_003550617.1| PREDICTED: DUF246 domain-containing protein ... 69 7e-10 ref|NP_001063294.1| Os09g0442900 [Oryza sativa Japonica Group] g... 68 1e-09 ref|XP_002279041.1| PREDICTED: DUF246 domain-containing protein ... 68 1e-09 gb|EEC84650.1| hypothetical protein OsI_31543 [Oryza sativa Indi... 68 1e-09 >ref|XP_002516284.1| conserved hypothetical protein [Ricinus communis] gi|223544770|gb|EEF46286.1| conserved hypothetical protein [Ricinus communis] Length = 684 Score = 69.7 bits (169), Expect = 3e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 584 NRIGAPYMREPGEFPKLEESFYANPFPGCICE 489 +R+GAPY+REPGEFPKLEESFYANP PGCICE Sbjct: 603 DRVGAPYLREPGEFPKLEESFYANPLPGCICE 634 >ref|XP_003550617.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 628 Score = 68.6 bits (166), Expect = 7e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 584 NRIGAPYMREPGEFPKLEESFYANPFPGCICE 489 +RIGAPY REPGEFPKLEESFYANP PGCICE Sbjct: 595 DRIGAPYPREPGEFPKLEESFYANPLPGCICE 626 >ref|NP_001063294.1| Os09g0442900 [Oryza sativa Japonica Group] gi|51536003|dbj|BAD38083.1| putative auxin-independent growth promoter [Oryza sativa Japonica Group] gi|113631527|dbj|BAF25208.1| Os09g0442900 [Oryza sativa Japonica Group] gi|222641672|gb|EEE69804.1| hypothetical protein OsJ_29537 [Oryza sativa Japonica Group] Length = 638 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 581 RIGAPYMREPGEFPKLEESFYANPFPGCICE 489 RIGAPY+REPGEFPKLEESF+ANP PGCICE Sbjct: 603 RIGAPYLREPGEFPKLEESFFANPLPGCICE 633 >ref|XP_002279041.1| PREDICTED: DUF246 domain-containing protein At1g04910 [Vitis vinifera] gi|297738571|emb|CBI27816.3| unnamed protein product [Vitis vinifera] Length = 634 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 584 NRIGAPYMREPGEFPKLEESFYANPFPGCICE 489 +R GAPY+REPGEFPKLEESFYANP PGCICE Sbjct: 598 DRAGAPYLREPGEFPKLEESFYANPLPGCICE 629 >gb|EEC84650.1| hypothetical protein OsI_31543 [Oryza sativa Indica Group] Length = 638 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 581 RIGAPYMREPGEFPKLEESFYANPFPGCICE 489 RIGAPY+REPGEFPKLEESF+ANP PGCICE Sbjct: 603 RIGAPYLREPGEFPKLEESFFANPLPGCICE 633