BLASTX nr result
ID: Papaver22_contig00006899
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00006899 (421 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539674.1| PREDICTED: probable protein phosphatase 2C 4... 116 2e-24 ref|XP_002534107.1| protein phosphatase 2c, putative [Ricinus co... 115 4e-24 ref|XP_002313436.1| predicted protein [Populus trichocarpa] gi|2... 114 6e-24 ref|XP_002298358.1| predicted protein [Populus trichocarpa] gi|2... 114 6e-24 ref|XP_003537993.1| PREDICTED: probable protein phosphatase 2C 4... 114 8e-24 >ref|XP_003539674.1| PREDICTED: probable protein phosphatase 2C 4-like [Glycine max] Length = 720 Score = 116 bits (291), Expect = 2e-24 Identities = 54/57 (94%), Positives = 57/57 (100%) Frame = -3 Query: 419 GDPAQHLIEEVLFRAAKKAGLDFHDLLEIPQGDRRRYHDDVSIIVISLEGRIWRSCM 249 GDPAQHL+EEVLFRAAKKAGLDFH+LLEIPQGDRRRYHDDVSIIVISLEGRIWRSC+ Sbjct: 664 GDPAQHLVEEVLFRAAKKAGLDFHELLEIPQGDRRRYHDDVSIIVISLEGRIWRSCV 720 >ref|XP_002534107.1| protein phosphatase 2c, putative [Ricinus communis] gi|223525839|gb|EEF28275.1| protein phosphatase 2c, putative [Ricinus communis] Length = 702 Score = 115 bits (288), Expect = 4e-24 Identities = 52/57 (91%), Positives = 57/57 (100%) Frame = -3 Query: 419 GDPAQHLIEEVLFRAAKKAGLDFHDLLEIPQGDRRRYHDDVSIIVISLEGRIWRSCM 249 GDPAQHL+EEVLFRAAKKAG+DFH+LLEIPQGDRRRYHDD+SIIVISLEGRIWRSC+ Sbjct: 646 GDPAQHLVEEVLFRAAKKAGMDFHELLEIPQGDRRRYHDDISIIVISLEGRIWRSCV 702 >ref|XP_002313436.1| predicted protein [Populus trichocarpa] gi|222849844|gb|EEE87391.1| predicted protein [Populus trichocarpa] Length = 670 Score = 114 bits (286), Expect = 6e-24 Identities = 52/57 (91%), Positives = 57/57 (100%) Frame = -3 Query: 419 GDPAQHLIEEVLFRAAKKAGLDFHDLLEIPQGDRRRYHDDVSIIVISLEGRIWRSCM 249 GDPAQHL+EEVLFRAAKKAG+DFH+LL+IPQGDRRRYHDDVSIIVISLEGRIWRSC+ Sbjct: 614 GDPAQHLVEEVLFRAAKKAGMDFHELLQIPQGDRRRYHDDVSIIVISLEGRIWRSCV 670 >ref|XP_002298358.1| predicted protein [Populus trichocarpa] gi|222845616|gb|EEE83163.1| predicted protein [Populus trichocarpa] Length = 667 Score = 114 bits (286), Expect = 6e-24 Identities = 52/57 (91%), Positives = 57/57 (100%) Frame = -3 Query: 419 GDPAQHLIEEVLFRAAKKAGLDFHDLLEIPQGDRRRYHDDVSIIVISLEGRIWRSCM 249 GDPAQHL+EEVLFRAAKKAG+DFH+LL+IPQGDRRRYHDDVSIIVISLEGRIWRSC+ Sbjct: 611 GDPAQHLVEEVLFRAAKKAGMDFHELLDIPQGDRRRYHDDVSIIVISLEGRIWRSCV 667 >ref|XP_003537993.1| PREDICTED: probable protein phosphatase 2C 4-like isoform 2 [Glycine max] Length = 687 Score = 114 bits (285), Expect = 8e-24 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = -3 Query: 419 GDPAQHLIEEVLFRAAKKAGLDFHDLLEIPQGDRRRYHDDVSIIVISLEGRIWRSCM 249 GDPAQHL+EEVLFRAAKKAGLDFH+LLEIPQGDRRRYHDDVSIIVISLEGRIWR C+ Sbjct: 631 GDPAQHLVEEVLFRAAKKAGLDFHELLEIPQGDRRRYHDDVSIIVISLEGRIWRFCV 687