BLASTX nr result
ID: Papaver22_contig00006530
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00006530 (575 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271807.1| PREDICTED: stromal cell-derived factor 2-lik... 134 8e-30 ref|NP_565585.1| stromal cell-derived factor 2-like protein [Ara... 133 2e-29 ref|XP_002878825.1| MIR domain-containing protein [Arabidopsis l... 133 2e-29 pdb|3MAL|A Chain A, Crystal Structure Of The Sdf2-Like Protein F... 133 2e-29 gb|ACU24458.1| unknown [Glycine max] 133 2e-29 >ref|XP_002271807.1| PREDICTED: stromal cell-derived factor 2-like protein [Vitis vinifera] gi|297745088|emb|CBI38927.3| unnamed protein product [Vitis vinifera] Length = 214 Score = 134 bits (338), Expect = 8e-30 Identities = 61/68 (89%), Positives = 64/68 (94%) Frame = +1 Query: 1 EIEGKGKTWRQDQRVRLQHVDTGGYLHSHDKKYTRIAGGQQEVCGVREKRPDNVWLAAEG 180 EIEG GKTW+QDQRVRL HVDTGGYLHSHDKKYTRIAGGQQEVCGVR+KR DNVWLA EG Sbjct: 147 EIEGSGKTWKQDQRVRLLHVDTGGYLHSHDKKYTRIAGGQQEVCGVRDKRADNVWLAVEG 206 Query: 181 VYLPVNEA 204 VYLPVNE+ Sbjct: 207 VYLPVNES 214 >ref|NP_565585.1| stromal cell-derived factor 2-like protein [Arabidopsis thaliana] gi|24212393|sp|Q93ZE8.1|SDF2_ARATH RecName: Full=Stromal cell-derived factor 2-like protein; Short=SDF2-like protein; Flags: Precursor gi|16209645|gb|AAL14383.1| At2g25110/F13D4.70 [Arabidopsis thaliana] gi|23505803|gb|AAN28761.1| At2g25110/F13D4.70 [Arabidopsis thaliana] gi|330252565|gb|AEC07659.1| stromal cell-derived factor 2-like protein [Arabidopsis thaliana] Length = 218 Score = 133 bits (335), Expect = 2e-29 Identities = 58/69 (84%), Positives = 65/69 (94%) Frame = +1 Query: 4 IEGKGKTWRQDQRVRLQHVDTGGYLHSHDKKYTRIAGGQQEVCGVREKRPDNVWLAAEGV 183 IEG GKTW+QDQRVRLQH+DT GYLHSHDKKY RIAGGQQEVCG+REK+ DN+WLAAEGV Sbjct: 150 IEGSGKTWKQDQRVRLQHIDTSGYLHSHDKKYQRIAGGQQEVCGIREKKADNIWLAAEGV 209 Query: 184 YLPVNEASK 210 YLP+NE+SK Sbjct: 210 YLPLNESSK 218 >ref|XP_002878825.1| MIR domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297324664|gb|EFH55084.1| MIR domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 218 Score = 133 bits (335), Expect = 2e-29 Identities = 58/69 (84%), Positives = 65/69 (94%) Frame = +1 Query: 4 IEGKGKTWRQDQRVRLQHVDTGGYLHSHDKKYTRIAGGQQEVCGVREKRPDNVWLAAEGV 183 IEG GKTW+QDQRVRLQH+DT GYLHSHDKKY RIAGGQQEVCG+REK+ DN+WLAAEGV Sbjct: 150 IEGSGKTWKQDQRVRLQHIDTSGYLHSHDKKYQRIAGGQQEVCGIREKKADNIWLAAEGV 209 Query: 184 YLPVNEASK 210 YLP+NE+SK Sbjct: 210 YLPLNESSK 218 >pdb|3MAL|A Chain A, Crystal Structure Of The Sdf2-Like Protein From Arabidopsis gi|293652062|pdb|3MAL|B Chain B, Crystal Structure Of The Sdf2-Like Protein From Arabidopsis Length = 199 Score = 133 bits (335), Expect = 2e-29 Identities = 58/69 (84%), Positives = 65/69 (94%) Frame = +1 Query: 4 IEGKGKTWRQDQRVRLQHVDTGGYLHSHDKKYTRIAGGQQEVCGVREKRPDNVWLAAEGV 183 IEG GKTW+QDQRVRLQH+DT GYLHSHDKKY RIAGGQQEVCG+REK+ DN+WLAAEGV Sbjct: 131 IEGSGKTWKQDQRVRLQHIDTSGYLHSHDKKYQRIAGGQQEVCGIREKKADNIWLAAEGV 190 Query: 184 YLPVNEASK 210 YLP+NE+SK Sbjct: 191 YLPLNESSK 199 >gb|ACU24458.1| unknown [Glycine max] Length = 222 Score = 133 bits (335), Expect = 2e-29 Identities = 59/67 (88%), Positives = 64/67 (95%) Frame = +1 Query: 4 IEGKGKTWRQDQRVRLQHVDTGGYLHSHDKKYTRIAGGQQEVCGVREKRPDNVWLAAEGV 183 IEG GKTW+QDQR+RLQH+DTGGYLHSHDKKY+RIAGGQQEVCGVREKR DNVWLAAEGV Sbjct: 155 IEGSGKTWKQDQRIRLQHIDTGGYLHSHDKKYSRIAGGQQEVCGVREKRADNVWLAAEGV 214 Query: 184 YLPVNEA 204 YLPV E+ Sbjct: 215 YLPVTES 221