BLASTX nr result
ID: Papaver22_contig00006260
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00006260 (911 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521095.1| 60S ribosomal protein L13a, putative [Ricinu... 52 8e-06 >ref|XP_002521095.1| 60S ribosomal protein L13a, putative [Ricinus communis] gi|223539664|gb|EEF41246.1| 60S ribosomal protein L13a, putative [Ricinus communis] Length = 206 Score = 52.0 bits (123), Expect(2) = 8e-06 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = +3 Query: 30 HTRPSEAAAVS*FEAYEGIPPPYDKIKRMVIPDALKCM 143 H AA++ + YEGIPPPYDKIKRMVIPDALK + Sbjct: 95 HKTKRGEAALARLKVYEGIPPPYDKIKRMVIPDALKVL 132 Score = 24.3 bits (51), Expect(2) = 8e-06 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 Query: 8 KTILFVIPHKTKRG 49 +T+ +IPHKTKRG Sbjct: 87 RTVRGMIPHKTKRG 100