BLASTX nr result
ID: Papaver22_contig00006066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00006066 (494 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511317.1| conserved hypothetical protein [Ricinus comm... 68 9e-10 >ref|XP_002511317.1| conserved hypothetical protein [Ricinus communis] gi|223550432|gb|EEF51919.1| conserved hypothetical protein [Ricinus communis] Length = 109 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/70 (45%), Positives = 42/70 (60%) Frame = -1 Query: 425 GWQTTSDDYYVHVSRMERMPSTIVEAPKFPNFHSLFNNKKIANIXXXXTDHEEVVVQKEK 246 GW TTS DY+VHVS MERMPS + + P++PN H FNNK I T E + Q++ Sbjct: 13 GWDTTSTDYHVHVSTMERMPSILPDVPRYPNVHRAFNNKTIHEDEFEVTHQESMQKQRQP 72 Query: 245 PSETTKSSTV 216 P+ K T+ Sbjct: 73 PTTHGKKRTL 82