BLASTX nr result
ID: Papaver22_contig00005405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00005405 (703 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI38698.3| unnamed protein product [Vitis vinifera] 56 6e-06 >emb|CBI38698.3| unnamed protein product [Vitis vinifera] Length = 440 Score = 56.2 bits (134), Expect = 6e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 703 DTLEFHKFYKSFSSGLQDIVWTSKAITEESR 611 DTLEFHKFYKSFSSGL+DIVW S+A TEE R Sbjct: 409 DTLEFHKFYKSFSSGLKDIVWKSEANTEELR 439