BLASTX nr result
ID: Papaver22_contig00004780
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00004780 (759 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313779.1| predicted protein [Populus trichocarpa] gi|2... 72 1e-10 ref|XP_003627749.1| hypothetical protein MTR_8g037800 [Medicago ... 67 5e-09 ref|NP_001236665.1| uncharacterized protein LOC100500603 precurs... 67 5e-09 emb|CAN82852.1| hypothetical protein VITISV_041720 [Vitis vinifera] 63 8e-08 ref|XP_002283641.1| PREDICTED: uncharacterized protein LOC100245... 62 1e-07 >ref|XP_002313779.1| predicted protein [Populus trichocarpa] gi|222850187|gb|EEE87734.1| predicted protein [Populus trichocarpa] Length = 94 Score = 72.0 bits (175), Expect = 1e-10 Identities = 40/74 (54%), Positives = 50/74 (67%), Gaps = 1/74 (1%) Frame = -3 Query: 580 AGREWKFVEKPAA-MDLGATNKQEMSSRKLVQHKNEAPLTSEIHERLLRVNTKDYGRYDP 404 AGR K V K A +++ A +E+SS+ H NEA + IHERLL+ NTKDYG Y P Sbjct: 26 AGRRSKSVNKLAEEVEVSAATYEEISSKP--SHNNEA---TTIHERLLKANTKDYGNYKP 80 Query: 403 SPTLVKPPFKLIPN 362 +P LV+PPFKLIPN Sbjct: 81 APALVRPPFKLIPN 94 >ref|XP_003627749.1| hypothetical protein MTR_8g037800 [Medicago truncatula] gi|355521771|gb|AET02225.1| hypothetical protein MTR_8g037800 [Medicago truncatula] gi|388492214|gb|AFK34173.1| unknown [Medicago truncatula] Length = 91 Score = 66.6 bits (161), Expect = 5e-09 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = -3 Query: 481 NEAPLTSEIHERLLRVNTKDYGRYDPSPTLVKPPFKLIPN 362 NE + S IHERLLR NTKDYGRYDPSPT KPPFKLIPN Sbjct: 53 NEEEVRS-IHERLLRANTKDYGRYDPSPTFSKPPFKLIPN 91 >ref|NP_001236665.1| uncharacterized protein LOC100500603 precursor [Glycine max] gi|255630736|gb|ACU15729.1| unknown [Glycine max] Length = 93 Score = 66.6 bits (161), Expect = 5e-09 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 4/41 (9%) Frame = -3 Query: 472 PLTSE----IHERLLRVNTKDYGRYDPSPTLVKPPFKLIPN 362 PL E IHERLLR NTKDYGRYDPSP+L KPPFKLIPN Sbjct: 53 PLNKEEVRTIHERLLRANTKDYGRYDPSPSLSKPPFKLIPN 93 >emb|CAN82852.1| hypothetical protein VITISV_041720 [Vitis vinifera] Length = 249 Score = 62.8 bits (151), Expect = 8e-08 Identities = 31/48 (64%), Positives = 33/48 (68%) Frame = -3 Query: 505 SRKLVQHKNEAPLTSEIHERLLRVNTKDYGRYDPSPTLVKPPFKLIPN 362 SRK H A IHERLLR NT+DYG YDP+P L KPPFKLIPN Sbjct: 205 SRKPSHHYRRA---EAIHERLLRANTRDYGNYDPAPALGKPPFKLIPN 249 >ref|XP_002283641.1| PREDICTED: uncharacterized protein LOC100245294 [Vitis vinifera] gi|297744426|emb|CBI37688.3| unnamed protein product [Vitis vinifera] Length = 95 Score = 62.0 bits (149), Expect = 1e-07 Identities = 34/73 (46%), Positives = 44/73 (60%) Frame = -3 Query: 580 AGREWKFVEKPAAMDLGATNKQEMSSRKLVQHKNEAPLTSEIHERLLRVNTKDYGRYDPS 401 AGR K K ++ + +E+S + Q++ IHERLLR NT+DYG YDP+ Sbjct: 29 AGRRSKLASK--SIHVADAVFKEISRKPSHQYRR----AEAIHERLLRANTRDYGNYDPA 82 Query: 400 PTLVKPPFKLIPN 362 P L KPPFKLIPN Sbjct: 83 PALGKPPFKLIPN 95