BLASTX nr result
ID: Papaver22_contig00003953
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00003953 (2421 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_190048.2| protein-tyrosine phosphatase [Arabidopsis thali... 61 1e-06 ref|XP_002875678.1| hypothetical protein ARALYDRAFT_905578 [Arab... 61 1e-06 ref|XP_002875675.1| protein tyrosine phosphatase [Arabidopsis ly... 61 1e-06 gb|ACJ64858.1| disease resistance protein RPP1-like protein R4 [... 61 1e-06 emb|CAB72464.1| protein-tyrosine-phosphatase-like protein [Arabi... 61 1e-06 >ref|NP_190048.2| protein-tyrosine phosphatase [Arabidopsis thaliana] gi|51968484|dbj|BAD42934.1| protein-tyrosine-phosphatase-like protein [Arabidopsis thaliana] gi|51971184|dbj|BAD44284.1| protein-tyrosine-phosphatase-like protein [Arabidopsis thaliana] gi|332644401|gb|AEE77922.1| protein-tyrosine phosphatase [Arabidopsis thaliana] Length = 239 Score = 61.2 bits (147), Expect = 1e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 1930 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 2031 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 187 ADKKVKLMCSYCKKHNDKFVPDPYYGGAQGFEKV 220 >ref|XP_002875678.1| hypothetical protein ARALYDRAFT_905578 [Arabidopsis lyrata subsp. lyrata] gi|297321516|gb|EFH51937.1| hypothetical protein ARALYDRAFT_905578 [Arabidopsis lyrata subsp. lyrata] Length = 227 Score = 61.2 bits (147), Expect = 1e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 1930 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 2031 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 175 ADKKVKLMCSYCKKHNDKFVPDPYYGGAQGFEKV 208 >ref|XP_002875675.1| protein tyrosine phosphatase [Arabidopsis lyrata subsp. lyrata] gi|297321513|gb|EFH51934.1| protein tyrosine phosphatase [Arabidopsis lyrata subsp. lyrata] Length = 236 Score = 61.2 bits (147), Expect = 1e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 1930 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 2031 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 184 ADKKVKLMCSYCKKHNDKFVPDPYYGGAQGFEKV 217 >gb|ACJ64858.1| disease resistance protein RPP1-like protein R4 [Arabidopsis thaliana] Length = 1363 Score = 61.2 bits (147), Expect = 1e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 1930 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 2031 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 63 ADKKVKLMCSYCKKHNDKFVPDPYYGGAQGFEKV 96 Score = 58.5 bits (140), Expect = 8e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 1936 REVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 2031 R+VKLMC YCKKHN+K V DPYYGG Q FEKV Sbjct: 1321 RKVKLMCSYCKKHNDKFVHDPYYGGAQSFEKV 1352 >emb|CAB72464.1| protein-tyrosine-phosphatase-like protein [Arabidopsis thaliana] gi|34365639|gb|AAQ65131.1| At3g44620 [Arabidopsis thaliana] Length = 177 Score = 61.2 bits (147), Expect = 1e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 1930 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 2031 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 125 ADKKVKLMCSYCKKHNDKFVPDPYYGGAQGFEKV 158