BLASTX nr result
ID: Papaver22_contig00003356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00003356 (608 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGE93346.1| hypothetical chloroplast RF21 [Chamaedorea seifri... 58 1e-06 gb|AEZ48735.1| hypothetical chloroplast RF2, partial [Chamaedore... 58 1e-06 gb|AEZ48731.1| hypothetical chloroplast RF2 [Albuca kirkii] 58 1e-06 gb|AEX93976.1| hypothetical chloroplast RF21 (chloroplast) [Cali... 58 1e-06 gb|AEX93974.1| hypothetical chloroplast RF21 (chloroplast) [Ozir... 58 1e-06 >gb|AGE93346.1| hypothetical chloroplast RF21 [Chamaedorea seifrizii] Length = 2277 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 375 MKRHQFKSWIFELREIKNSHYFLDSEVVRINSLG 274 MKRHQFKSWIFELREIKNSHYFLDS ++ +S+G Sbjct: 1 MKRHQFKSWIFELREIKNSHYFLDS-WIKFDSVG 33 >gb|AEZ48735.1| hypothetical chloroplast RF2, partial [Chamaedorea seifrizii] gi|449326748|gb|AGE93327.1| hypothetical chloroplast RF21 [Chamaedorea seifrizii] Length = 2284 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 375 MKRHQFKSWIFELREIKNSHYFLDSEVVRINSLG 274 MKRHQFKSWIFELREIKNSHYFLDS ++ +S+G Sbjct: 1 MKRHQFKSWIFELREIKNSHYFLDS-WIKFDSVG 33 >gb|AEZ48731.1| hypothetical chloroplast RF2 [Albuca kirkii] Length = 2270 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 375 MKRHQFKSWIFELREIKNSHYFLDSEVVRINSLG 274 MKRHQFKSWIFELREIKNSHYFLDS ++ +S+G Sbjct: 1 MKRHQFKSWIFELREIKNSHYFLDS-WIKFDSVG 33 >gb|AEX93976.1| hypothetical chloroplast RF21 (chloroplast) [Calibanus hookerii] Length = 2238 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 375 MKRHQFKSWIFELREIKNSHYFLDSEVVRINSLG 274 MKRHQFKSWIFELREIKNSHYFLDS ++ +S+G Sbjct: 1 MKRHQFKSWIFELREIKNSHYFLDS-WIKFDSVG 33 >gb|AEX93974.1| hypothetical chloroplast RF21 (chloroplast) [Oziroe biflora] Length = 2260 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 375 MKRHQFKSWIFELREIKNSHYFLDSEVVRINSLG 274 MKRHQFKSWIFELREIKNSHYFLDS ++ +S+G Sbjct: 1 MKRHQFKSWIFELREIKNSHYFLDS-WIKFDSVG 33