BLASTX nr result
ID: Papaver22_contig00002719
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00002719 (724 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001620118.1| hypothetical protein NEMVEDRAFT_v1g6787 [Nem... 61 2e-07 >ref|XP_001620118.1| hypothetical protein NEMVEDRAFT_v1g6787 [Nematostella vectensis] gi|156204524|gb|EDO28018.1| predicted protein [Nematostella vectensis] Length = 166 Score = 61.2 bits (147), Expect = 2e-07 Identities = 24/85 (28%), Positives = 33/85 (38%), Gaps = 6/85 (7%) Frame = -2 Query: 345 CCLWSTMMFMAGKSSRCWWVNYRCSCWWYY--RFNWWLNYG*NCW----CSCWCIYFFNW 184 C WS + C W + C C W+ WW W C+ W +Y++ W Sbjct: 46 CTWWSVYYYTLWSVYDCTWWSVLCDCTWWSVCGSTWWSVCDCTWWSVYNCTWWSVYYYTW 105 Query: 183 WRTYGCNCWWKYWRASWRDYWCGCW 109 W +GC W Y+ W Y C W Sbjct: 106 WSVFGCTWWSVYYYTLWSVYDCTWW 130