BLASTX nr result
ID: Papaver22_contig00002603
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00002603 (547 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEL98926.1| cysteinyl-tRNA synthetase, partial [Silene latifo... 45 2e-09 gb|AEL98925.1| cysteinyl-tRNA synthetase, partial [Silene latifo... 45 4e-09 dbj|BAI45221.1| cysteinyl tRNA synthetase [Beta vulgaris] 43 1e-08 dbj|BAI45220.1| cysteinyl tRNA synthetase [Beta vulgaris] 43 1e-08 ref|XP_002515479.1| cysteinyl-tRNA synthetase, putative [Ricinus... 42 1e-08 >gb|AEL98926.1| cysteinyl-tRNA synthetase, partial [Silene latifolia] Length = 411 Score = 45.4 bits (106), Expect(2) = 2e-09 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = +3 Query: 60 SCAARPNICEITYWIHNGFVNTNNENMSKSPGN 158 SCAA N + YW+HNGFVN N E MSKS GN Sbjct: 148 SCAAC-NEANVGYWVHNGFVNINGEKMSKSTGN 179 Score = 41.6 bits (96), Expect(2) = 2e-09 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +2 Query: 5 SFDIHGGEMDLIFPYHENEL 64 SFDIHGG +DLIFP+HENEL Sbjct: 126 SFDIHGGGIDLIFPHHENEL 145 >gb|AEL98925.1| cysteinyl-tRNA synthetase, partial [Silene latifolia] Length = 411 Score = 45.4 bits (106), Expect(2) = 4e-09 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = +3 Query: 60 SCAARPNICEITYWIHNGFVNTNNENMSKSPGN 158 SCAA N + YW+HNGFVN N E MSKS GN Sbjct: 148 SCAAC-NEANVGYWVHNGFVNINGEKMSKSTGN 179 Score = 40.4 bits (93), Expect(2) = 4e-09 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +2 Query: 5 SFDIHGGEMDLIFPYHENEL 64 +FDIHGG +DLIFP+HENEL Sbjct: 126 AFDIHGGGIDLIFPHHENEL 145 >dbj|BAI45221.1| cysteinyl tRNA synthetase [Beta vulgaris] Length = 582 Score = 42.7 bits (99), Expect(2) = 1e-08 Identities = 22/35 (62%), Positives = 24/35 (68%), Gaps = 2/35 (5%) Frame = +3 Query: 60 SCAARPNICE--ITYWIHNGFVNTNNENMSKSPGN 158 SCAA CE I YW+HNGFV N+E MSKS GN Sbjct: 323 SCAA---CCESNIRYWVHNGFVTINSEKMSKSLGN 354 Score = 41.2 bits (95), Expect(2) = 1e-08 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +2 Query: 5 SFDIHGGEMDLIFPYHENEL 64 SFDIHGG MDL+FP+HENE+ Sbjct: 301 SFDIHGGGMDLMFPHHENEI 320 >dbj|BAI45220.1| cysteinyl tRNA synthetase [Beta vulgaris] Length = 582 Score = 42.7 bits (99), Expect(2) = 1e-08 Identities = 22/35 (62%), Positives = 24/35 (68%), Gaps = 2/35 (5%) Frame = +3 Query: 60 SCAARPNICE--ITYWIHNGFVNTNNENMSKSPGN 158 SCAA CE I YW+HNGFV N+E MSKS GN Sbjct: 323 SCAA---CCESNIRYWVHNGFVTINSEKMSKSLGN 354 Score = 41.2 bits (95), Expect(2) = 1e-08 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +2 Query: 5 SFDIHGGEMDLIFPYHENEL 64 SFDIHGG MDL+FP+HENE+ Sbjct: 301 SFDIHGGGMDLMFPHHENEI 320 >ref|XP_002515479.1| cysteinyl-tRNA synthetase, putative [Ricinus communis] gi|223545423|gb|EEF46928.1| cysteinyl-tRNA synthetase, putative [Ricinus communis] Length = 563 Score = 42.0 bits (97), Expect(2) = 1e-08 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +2 Query: 5 SFDIHGGEMDLIFPYHENEL 64 SFDIHGG MDL+FP+HENE+ Sbjct: 288 SFDIHGGGMDLVFPHHENEI 307 Score = 42.0 bits (97), Expect(2) = 1e-08 Identities = 20/33 (60%), Positives = 23/33 (69%) Frame = +3 Query: 60 SCAARPNICEITYWIHNGFVNTNNENMSKSPGN 158 SCAA I+YW+HNGFV N+E MSKS GN Sbjct: 310 SCAACRG-SNISYWVHNGFVTINSEKMSKSLGN 341