BLASTX nr result
ID: Papaver22_contig00002016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00002016 (1237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK42956.1| unknown [Lotus japonicus] 57 1e-05 ref|XP_002522657.1| sentrin/sumo-specific protease, putative [Ri... 57 1e-05 >gb|AFK42956.1| unknown [Lotus japonicus] Length = 232 Score = 57.0 bits (136), Expect = 1e-05 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 410 PMMYGRGPMPAGIAMVLMVLPDGRVGYIL 324 PMMYGRGPMPAG+ MV MVLPDGR+GY+L Sbjct: 159 PMMYGRGPMPAGMQMVPMVLPDGRIGYVL 187 >ref|XP_002522657.1| sentrin/sumo-specific protease, putative [Ricinus communis] gi|223538133|gb|EEF39744.1| sentrin/sumo-specific protease, putative [Ricinus communis] Length = 887 Score = 57.0 bits (136), Expect = 1e-05 Identities = 23/62 (37%), Positives = 41/62 (66%) Frame = -3 Query: 737 VQTALVKICIRPITEKDVEDVNDDPGLLELQFAVFDTCWLEKHERICSLDAGYRALWKLV 558 V+TA++K+ ++P + V + N+ G+ EL+ +V+D CW E E I SLD YR +W ++ Sbjct: 279 VETAMIKLHLKPNVSESVGNSNESSGIDELKVSVYDPCWSEGQEAIKSLDVRYRDIWNVI 338 Query: 557 LE 552 ++ Sbjct: 339 ID 340