BLASTX nr result
ID: Papaver22_contig00000787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00000787 (784 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_174067.2| transducin family protein / WD-40 repeat family... 81 3e-13 tpg|DAA51196.1| TPA: hypothetical protein ZEAMMB73_926783 [Zea m... 79 1e-12 ref|NP_001078355.1| transducin/WD40 domain-containing protein [A... 79 1e-12 ref|NP_567317.2| transducin/WD40 domain-containing protein [Arab... 79 1e-12 gb|AAD48948.1|AF147262_11 contains similarity to Pfam family PF0... 79 1e-12 >ref|NP_174067.2| transducin family protein / WD-40 repeat family protein [Arabidopsis thaliana] gi|17979117|gb|AAL49816.1| unknown protein [Arabidopsis thaliana] gi|23297582|gb|AAN12900.1| unknown protein [Arabidopsis thaliana] gi|332192715|gb|AEE30836.1| transducin family protein / WD-40 repeat family protein [Arabidopsis thaliana] Length = 810 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/52 (69%), Positives = 41/52 (78%) Frame = -2 Query: 432 RVLSVAWSLDAKSIFSGSSDGFIRCWDAQTTHEVYKITVGMGGSYNRSDLCV 277 R LSV WS DA+ IFSGSSDG IRCWDA HEVY+ITVG+GG N S+LC+ Sbjct: 200 RALSVTWSADAQRIFSGSSDGLIRCWDANLCHEVYRITVGLGGLGNGSELCI 251 >tpg|DAA51196.1| TPA: hypothetical protein ZEAMMB73_926783 [Zea mays] Length = 816 Score = 79.0 bits (193), Expect = 1e-12 Identities = 34/52 (65%), Positives = 43/52 (82%) Frame = -2 Query: 432 RVLSVAWSLDAKSIFSGSSDGFIRCWDAQTTHEVYKITVGMGGSYNRSDLCV 277 R LSVAWS +AK +FSGSSDG IRCWD+ + HE+Y+ITVG+GG+ N +LCV Sbjct: 213 RTLSVAWSSNAKFVFSGSSDGLIRCWDSTSFHEMYRITVGLGGASNSPELCV 264 >ref|NP_001078355.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] gi|332657168|gb|AEE82568.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] Length = 702 Score = 78.6 bits (192), Expect = 1e-12 Identities = 35/52 (67%), Positives = 41/52 (78%) Frame = -2 Query: 432 RVLSVAWSLDAKSIFSGSSDGFIRCWDAQTTHEVYKITVGMGGSYNRSDLCV 277 R LSV WS DAK IFSGSSDG IRCWDA + HEVY+IT G+GG + S++CV Sbjct: 87 RALSVTWSPDAKRIFSGSSDGLIRCWDATSCHEVYRITAGLGGLGSSSEICV 138 >ref|NP_567317.2| transducin/WD40 domain-containing protein [Arabidopsis thaliana] gi|19347784|gb|AAL86343.1| unknown protein [Arabidopsis thaliana] gi|22136758|gb|AAM91698.1| unknown protein [Arabidopsis thaliana] gi|332657167|gb|AEE82567.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] Length = 815 Score = 78.6 bits (192), Expect = 1e-12 Identities = 35/52 (67%), Positives = 41/52 (78%) Frame = -2 Query: 432 RVLSVAWSLDAKSIFSGSSDGFIRCWDAQTTHEVYKITVGMGGSYNRSDLCV 277 R LSV WS DAK IFSGSSDG IRCWDA + HEVY+IT G+GG + S++CV Sbjct: 200 RALSVTWSPDAKRIFSGSSDGLIRCWDATSCHEVYRITAGLGGLGSSSEICV 251 >gb|AAD48948.1|AF147262_11 contains similarity to Pfam family PF00400 -WD domain, G-beta repeat; score=37.6, E=2.9e-07, N=3 [Arabidopsis thaliana] gi|7267337|emb|CAB81111.1| AT4g07410 [Arabidopsis thaliana] Length = 728 Score = 78.6 bits (192), Expect = 1e-12 Identities = 35/52 (67%), Positives = 41/52 (78%) Frame = -2 Query: 432 RVLSVAWSLDAKSIFSGSSDGFIRCWDAQTTHEVYKITVGMGGSYNRSDLCV 277 R LSV WS DAK IFSGSSDG IRCWDA + HEVY+IT G+GG + S++CV Sbjct: 234 RALSVTWSPDAKRIFSGSSDGLIRCWDATSCHEVYRITAGLGGLGSSSEICV 285