BLASTX nr result
ID: Papaver22_contig00000468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00000468 (486 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003541100.1| PREDICTED: mitochondrial import receptor sub... 65 4e-09 ref|XP_004145344.1| PREDICTED: mitochondrial import receptor sub... 65 6e-09 ref|XP_002519115.1| conserved hypothetical protein [Ricinus comm... 62 5e-08 ref|XP_002305407.1| predicted protein [Populus trichocarpa] gi|1... 60 2e-07 gb|ACF79903.1| unknown [Zea mays] gi|414871850|tpg|DAA50407.1| T... 57 1e-06 >ref|XP_003541100.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 1 [Glycine max] gi|356545339|ref|XP_003541101.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 2 [Glycine max] gi|255626599|gb|ACU13644.1| unknown [Glycine max] Length = 54 Score = 65.5 bits (158), Expect = 4e-09 Identities = 31/54 (57%), Positives = 40/54 (74%) Frame = -1 Query: 477 MFLGGMPRKPDKSAALKQLLNHGLMFAGFCGVVRVTPYILHYLYAENEQLTLDI 316 MF G RKPDK+AALKQL +H MF + V+RVTPY+LH+L AE E+L L++ Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGTWVVVIRVTPYVLHFLCAEKEELKLEL 54 >ref|XP_004145344.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449455208|ref|XP_004145345.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474805|ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474809|ref|XP_004154291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532212|ref|XP_004173076.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532214|ref|XP_004173077.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] Length = 54 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/53 (60%), Positives = 38/53 (71%) Frame = -1 Query: 477 MFLGGMPRKPDKSAALKQLLNHGLMFAGFCGVVRVTPYILHYLYAENEQLTLD 319 MF G RKPDK+AALKQL +H MF + V+RVTPY+LHYL E E+L LD Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLHYLSDEKEELKLD 53 >ref|XP_002519115.1| conserved hypothetical protein [Ricinus communis] gi|223541778|gb|EEF43326.1| conserved hypothetical protein [Ricinus communis] Length = 54 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/53 (52%), Positives = 37/53 (69%) Frame = -1 Query: 477 MFLGGMPRKPDKSAALKQLLNHGLMFAGFCGVVRVTPYILHYLYAENEQLTLD 319 MF G RKPDK+AALKQL H +F + ++RVTPY+LHYL + ++L LD Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHAAIFGAWVALIRVTPYVLHYLSDDKDELKLD 53 >ref|XP_002305407.1| predicted protein [Populus trichocarpa] gi|118484423|gb|ABK94088.1| unknown [Populus trichocarpa] gi|222848371|gb|EEE85918.1| predicted protein [Populus trichocarpa] Length = 54 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = -1 Query: 477 MFLGGMPRKPDKSAALKQLLNHGLMFAGFCGVVRVTPYILHYLYAENEQLTLD 319 MF G RKPDK+ ALKQL +H MF + V+RVTPY+LHYL E ++L L+ Sbjct: 1 MFPGMFMRKPDKAEALKQLKSHVAMFGAWVVVLRVTPYVLHYLSDEKDELKLE 53 >gb|ACF79903.1| unknown [Zea mays] gi|414871850|tpg|DAA50407.1| TPA: hypothetical protein ZEAMMB73_336113 [Zea mays] Length = 56 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/56 (48%), Positives = 38/56 (67%), Gaps = 2/56 (3%) Frame = -1 Query: 477 MFLGGMPRKPDKSAALKQLLNHGLMFAGFCGVVRVTPYILHYLYAEN--EQLTLDI 316 MFLG +PR+P K AA KQL +H ++ A V+R TPYILH+L + ++L LD+ Sbjct: 1 MFLGSLPRRPSKEAAYKQLRSHIIIMASCAAVIRATPYILHFLARDGDIQELKLDL 56