BLASTX nr result
ID: Papaver22_contig00000073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00000073 (982 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P80915.1|AMP1_MACIN RecName: Full=Antimicrobial peptide 1; Sh... 62 2e-07 >sp|P80915.1|AMP1_MACIN RecName: Full=Antimicrobial peptide 1; Short=AMP1; AltName: Full=MiAMP1; Flags: Precursor gi|2181943|emb|CAA71842.1| AMP1 [Macadamia integrifolia] Length = 102 Score = 62.4 bits (150), Expect = 2e-07 Identities = 26/57 (45%), Positives = 37/57 (64%) Frame = +1 Query: 61 VLMAVVSELANASSITMYRLGGCGGETRTYSRCGCSNLLYMGGYQFRYTGQSARMYN 231 +L+A+ SE+ N S+ T++ GC YS+CGCS + GGY F YTGQ+A +YN Sbjct: 15 MLIAMASEMVNGSAFTVWSGPGCNNRAERYSKCGCSAIHQKGGYDFSYTGQTAALYN 71