BLASTX nr result
ID: Panax25_contig00053179
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00053179 (504 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EOY18623.1 Uncharacterized protein TCM_043123 [Theobroma cacao] 58 5e-08 >EOY18623.1 Uncharacterized protein TCM_043123 [Theobroma cacao] Length = 97 Score = 57.8 bits (138), Expect = 5e-08 Identities = 22/39 (56%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +3 Query: 33 IHICLAPCMPFADPTGTSMAPWMAYEEPCIF-LILFISV 146 +++CLAPCMPFA+PT +PWMAYEEPCI+ + +++S+ Sbjct: 24 VYMCLAPCMPFAEPTEHRWSPWMAYEEPCIYSMYIYLSM 62