BLASTX nr result
ID: Panax25_contig00053056
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00053056 (487 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018379219.1 hypothetical protein CC77DRAFT_597948 [Alternaria... 145 1e-42 >XP_018379219.1 hypothetical protein CC77DRAFT_597948 [Alternaria alternata] OAG13798.1 hypothetical protein CC77DRAFT_597948 [Alternaria alternata] Length = 70 Score = 145 bits (365), Expect = 1e-42 Identities = 70/70 (100%), Positives = 70/70 (100%) Frame = -2 Query: 399 MSCQSVTCHSQPHSSCPAPGPEYSASRASADLAVKSYCISLQAPRDVTGTGGCNLLRMSA 220 MSCQSVTCHSQPHSSCPAPGPEYSASRASADLAVKSYCISLQAPRDVTGTGGCNLLRMSA Sbjct: 1 MSCQSVTCHSQPHSSCPAPGPEYSASRASADLAVKSYCISLQAPRDVTGTGGCNLLRMSA 60 Query: 219 SVTLSFLSTV 190 SVTLSFLSTV Sbjct: 61 SVTLSFLSTV 70