BLASTX nr result
ID: Panax25_contig00052998
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00052998 (499 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CCF72394.1 bHLH trascription factor [Nicotiana tabacum] CCF72396... 55 5e-06 XP_016494316.1 PREDICTED: LOW QUALITY PROTEIN: transcription fac... 55 7e-06 XP_009587187.1 PREDICTED: transcription factor bHLH137 [Nicotian... 55 7e-06 CCF72395.1 bHLH trascription factor [Nicotiana occidentalis subs... 55 7e-06 >CCF72394.1 bHLH trascription factor [Nicotiana tabacum] CCF72396.1 bHLH transcription factor [Nicotiana tabacum] Length = 260 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/42 (61%), Positives = 29/42 (69%) Frame = -3 Query: 497 QAQMPNILSEFQNNGQLLWDGDEQRQKFITQFGFTNNFSPFH 372 QA PN +S Q NGQLLW D+QRQKFI Q G +NNF FH Sbjct: 221 QAHFPNSIS--QGNGQLLWGADDQRQKFINQSGLSNNFCSFH 260 >XP_016494316.1 PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH137-like [Nicotiana tabacum] Length = 357 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/42 (61%), Positives = 29/42 (69%) Frame = -3 Query: 497 QAQMPNILSEFQNNGQLLWDGDEQRQKFITQFGFTNNFSPFH 372 QA PN +S Q NGQLLW D+QRQKFI Q G +NNF FH Sbjct: 318 QAHFPNSIS--QGNGQLLWGADDQRQKFINQSGLSNNFCSFH 357 >XP_009587187.1 PREDICTED: transcription factor bHLH137 [Nicotiana tomentosiformis] Length = 357 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/42 (61%), Positives = 29/42 (69%) Frame = -3 Query: 497 QAQMPNILSEFQNNGQLLWDGDEQRQKFITQFGFTNNFSPFH 372 QA PN +S Q NGQLLW D+QRQKFI Q G +NNF FH Sbjct: 318 QAHFPNSIS--QGNGQLLWGADDQRQKFINQSGLSNNFCSFH 357 >CCF72395.1 bHLH trascription factor [Nicotiana occidentalis subsp. hesperis] Length = 362 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/42 (61%), Positives = 29/42 (69%) Frame = -3 Query: 497 QAQMPNILSEFQNNGQLLWDGDEQRQKFITQFGFTNNFSPFH 372 QA PN +S Q NGQLLW D+QRQKFI Q G +NNF FH Sbjct: 323 QAHFPNSIS--QGNGQLLWGADDQRQKFINQSGLSNNFCSFH 362