BLASTX nr result
ID: Panax25_contig00052927
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00052927 (584 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN01073.1 hypothetical protein DCAR_009827 [Daucus carota subsp... 57 1e-09 >KZN01073.1 hypothetical protein DCAR_009827 [Daucus carota subsp. sativus] Length = 140 Score = 57.0 bits (136), Expect(2) = 1e-09 Identities = 28/48 (58%), Positives = 32/48 (66%), Gaps = 2/48 (4%) Frame = +3 Query: 180 SADSECDSTEF--NSIVSDCGIVAPMWEAQKDRTLDPGRRFVGCSMYK 317 S+ S C++ + I CGIVAP WEA KD TLDPGRRF GCS YK Sbjct: 2 SSSSSCNTKRGIQHGIKCRCGIVAPCWEAWKDGTLDPGRRFYGCSRYK 49 Score = 33.1 bits (74), Expect(2) = 1e-09 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = +2 Query: 410 EPKMYCRFFKWCDLPFTERSREVIKKIE 493 +P C FF+W + F+ER+REVI +++ Sbjct: 50 DPGRSCNFFQWAEPAFSERAREVIHELK 77