BLASTX nr result
ID: Panax25_contig00052850
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00052850 (540 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018385124.1 putative rRNA pseudouridine synthase [Alternaria ... 71 3e-11 XP_001931292.1 centromere/microtubule-binding protein CBF5 [Pyre... 69 2e-10 XP_003304379.1 hypothetical protein PTT_16958 [Pyrenophora teres... 69 2e-10 KNG47201.1 centromere microtubule-binding protein cbf5 [Stemphyl... 68 3e-10 XP_008023095.1 hypothetical protein SETTUDRAFT_167811 [Setosphae... 64 7e-09 XP_007693162.1 hypothetical protein COCMIDRAFT_9782 [Bipolaris o... 57 2e-06 XP_003844439.1 similar to centromere/microtubule-binding protein... 57 3e-06 XP_007712171.1 hypothetical protein COCCADRAFT_36662 [Bipolaris ... 55 8e-06 >XP_018385124.1 putative rRNA pseudouridine synthase [Alternaria alternata] OAG19703.1 putative rRNA pseudouridine synthase [Alternaria alternata] Length = 497 Score = 71.2 bits (173), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 540 KDFNRNDVDGASAPVAETTSTSEVLAAPAVPATGL 436 KDFNRNDVDGASAPVAETTSTSEVLAAPAVPATGL Sbjct: 393 KDFNRNDVDGASAPVAETTSTSEVLAAPAVPATGL 427 >XP_001931292.1 centromere/microtubule-binding protein CBF5 [Pyrenophora tritici-repentis Pt-1C-BFP] EDU40397.1 centromere/microtubule-binding protein CBF5 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 499 Score = 68.6 bits (166), Expect = 2e-10 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -1 Query: 540 KDFNRNDVDGASAPVAETTSTSEVLAAPAVPATGL 436 KDFNRNDVDGASAPVA+TTST+EVLAAPA+PATGL Sbjct: 393 KDFNRNDVDGASAPVAQTTSTAEVLAAPAIPATGL 427 >XP_003304379.1 hypothetical protein PTT_16958 [Pyrenophora teres f. teres 0-1] EFQ87515.1 hypothetical protein PTT_16958 [Pyrenophora teres f. teres 0-1] Length = 499 Score = 68.6 bits (166), Expect = 2e-10 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -1 Query: 540 KDFNRNDVDGASAPVAETTSTSEVLAAPAVPATGL 436 KDFNRNDVDGASAPVA+TTST+EVLAAPA+PATGL Sbjct: 393 KDFNRNDVDGASAPVAQTTSTAEVLAAPAIPATGL 427 >KNG47201.1 centromere microtubule-binding protein cbf5 [Stemphylium lycopersici] Length = 500 Score = 68.2 bits (165), Expect = 3e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 540 KDFNRNDVDGASAPVAETTSTSEVLAAPAVPATGL 436 KDFNRNDVDGASAPVA+TTSTSEVLAAPAVP TGL Sbjct: 393 KDFNRNDVDGASAPVAQTTSTSEVLAAPAVPPTGL 427 >XP_008023095.1 hypothetical protein SETTUDRAFT_167811 [Setosphaeria turcica Et28A] EOA89275.1 hypothetical protein SETTUDRAFT_167811 [Setosphaeria turcica Et28A] Length = 499 Score = 64.3 bits (155), Expect = 7e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 540 KDFNRNDVDGASAPVAETTSTSEVLAAPAVPATGL 436 KDFNR DVDGA+APVA+TTSTSEVLAAPA+P TGL Sbjct: 393 KDFNRTDVDGAAAPVAQTTSTSEVLAAPAIPPTGL 427 >XP_007693162.1 hypothetical protein COCMIDRAFT_9782 [Bipolaris oryzae ATCC 44560] XP_007696612.1 hypothetical protein COCSADRAFT_34430 [Bipolaris sorokiniana ND90Pr] XP_014076545.1 hypothetical protein COCC4DRAFT_144755 [Bipolaris maydis ATCC 48331] EMD67636.1 hypothetical protein COCSADRAFT_34430 [Bipolaris sorokiniana ND90Pr] EMD91880.1 hypothetical protein COCHEDRAFT_1133778 [Bipolaris maydis C5] ENI02636.1 hypothetical protein COCC4DRAFT_144755 [Bipolaris maydis ATCC 48331] EUC40311.1 hypothetical protein COCMIDRAFT_9782 [Bipolaris oryzae ATCC 44560] Length = 495 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 540 KDFNRNDVDGASAPVAETTSTSEVLAAPAVPATG 439 KDFNR DVDGASAP+A+TTSTS+VLAAP V TG Sbjct: 393 KDFNRTDVDGASAPLAQTTSTSDVLAAPPVAPTG 426 >XP_003844439.1 similar to centromere/microtubule-binding protein cbf5 [Leptosphaeria maculans JN3] CBY00960.1 similar to centromere/microtubule-binding protein cbf5 [Leptosphaeria maculans JN3] Length = 488 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 540 KDFNRNDVDGASAPVAETTSTSEVLAAPAVPATG 439 KDFNR DVDG SAPVAETTS ++VLAAPAV TG Sbjct: 393 KDFNRTDVDGVSAPVAETTSAADVLAAPAVAPTG 426 >XP_007712171.1 hypothetical protein COCCADRAFT_36662 [Bipolaris zeicola 26-R-13] XP_014559840.1 hypothetical protein COCVIDRAFT_13226 [Bipolaris victoriae FI3] EUC33545.1 hypothetical protein COCCADRAFT_36662 [Bipolaris zeicola 26-R-13] EUN30298.1 hypothetical protein COCVIDRAFT_13226 [Bipolaris victoriae FI3] Length = 495 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 540 KDFNRNDVDGASAPVAETTSTSEVLAAPAVPATG 439 KDFNR DVDGAS P+A+TTSTS+VLAAP V TG Sbjct: 393 KDFNRTDVDGASVPLAQTTSTSDVLAAPPVAPTG 426