BLASTX nr result
ID: Panax25_contig00052647
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00052647 (456 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018387901.1 TPT-domain-containing protein [Alternaria alterna... 91 8e-19 XP_008029258.1 hypothetical protein SETTUDRAFT_164895 [Setosphae... 85 1e-16 XP_007700564.1 hypothetical protein COCSADRAFT_181722 [Bipolaris... 84 4e-16 XP_001941770.1 hypothetical protein PTRG_11439 [Pyrenophora trit... 84 5e-16 XP_007690756.1 hypothetical protein COCMIDRAFT_102746 [Bipolaris... 82 1e-15 XP_007708486.1 hypothetical protein COCCADRAFT_86089 [Bipolaris ... 82 2e-15 KNG45334.1 duf250 domain-containing membrane protein [Stemphyliu... 82 3e-15 OAL43888.1 TPT-domain-containing protein [Pyrenochaeta sp. DS3sA... 80 9e-15 XP_003305836.1 hypothetical protein PTT_18786 [Pyrenophora teres... 80 9e-15 OAK99392.1 TPT-domain-containing protein [Stagonospora sp. SRC1l... 75 4e-13 XP_001799951.1 hypothetical protein SNOG_09663 [Parastagonospora... 75 5e-13 XP_003839343.1 hypothetical protein LEMA_P030160.1 [Leptosphaeri... 70 2e-12 XP_018041742.1 TPT-domain-containing protein [Paraphaeosphaeria ... 71 1e-11 KZM23508.1 integral component of membrane [Ascochyta rabiei] 64 4e-09 >XP_018387901.1 TPT-domain-containing protein [Alternaria alternata] OAG22480.1 TPT-domain-containing protein [Alternaria alternata] Length = 401 Score = 91.3 bits (225), Expect = 8e-19 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 RKLMVFAAVVIGMFLVLGSLGPRYAPDSTNQVYNGIGKLIGDKAV 135 RKLMVFAAVVIGMFLVLGSLGPRYAPDSTNQVYNGIGKLIGDKAV Sbjct: 357 RKLMVFAAVVIGMFLVLGSLGPRYAPDSTNQVYNGIGKLIGDKAV 401 >XP_008029258.1 hypothetical protein SETTUDRAFT_164895 [Setosphaeria turcica Et28A] EOA83585.1 hypothetical protein SETTUDRAFT_164895 [Setosphaeria turcica Et28A] Length = 402 Score = 85.1 bits (209), Expect = 1e-16 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = +1 Query: 1 RKLMVFAAVVIGMFLVLGSLGPRYAPDSTNQVYNGIGKLIGDKAV 135 RKLMVF AV+I MF +LGSLGPRYAPDSTNQVYNGIGKLIGDKAV Sbjct: 358 RKLMVFTAVIISMFFILGSLGPRYAPDSTNQVYNGIGKLIGDKAV 402 >XP_007700564.1 hypothetical protein COCSADRAFT_181722 [Bipolaris sorokiniana ND90Pr] EMD63451.1 hypothetical protein COCSADRAFT_181722 [Bipolaris sorokiniana ND90Pr] Length = 402 Score = 84.0 bits (206), Expect = 4e-16 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = +1 Query: 1 RKLMVFAAVVIGMFLVLGSLGPRYAPDSTNQVYNGIGKLIGDKAV 135 RKLMVF+AV+I MFL+ GSLGPRYAP+STNQVYNGIGKLIGDKAV Sbjct: 358 RKLMVFSAVIISMFLIFGSLGPRYAPESTNQVYNGIGKLIGDKAV 402 >XP_001941770.1 hypothetical protein PTRG_11439 [Pyrenophora tritici-repentis Pt-1C-BFP] EDU44489.1 hypothetical protein PTRG_11439 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 402 Score = 83.6 bits (205), Expect = 5e-16 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = +1 Query: 1 RKLMVFAAVVIGMFLVLGSLGPRYAPDSTNQVYNGIGKLIGDKAV 135 RKLM+F AVVI +F +LGSLGPRYAPDSTNQVYNGIGKLIGDKAV Sbjct: 358 RKLMIFTAVVISVFFILGSLGPRYAPDSTNQVYNGIGKLIGDKAV 402 >XP_007690756.1 hypothetical protein COCMIDRAFT_102746 [Bipolaris oryzae ATCC 44560] XP_014073717.1 hypothetical protein COCC4DRAFT_76261 [Bipolaris maydis ATCC 48331] EMD85757.1 hypothetical protein COCHEDRAFT_1187616 [Bipolaris maydis C5] ENH99855.1 hypothetical protein COCC4DRAFT_76261 [Bipolaris maydis ATCC 48331] EUC42714.1 hypothetical protein COCMIDRAFT_102746 [Bipolaris oryzae ATCC 44560] Length = 402 Score = 82.4 bits (202), Expect = 1e-15 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +1 Query: 1 RKLMVFAAVVIGMFLVLGSLGPRYAPDSTNQVYNGIGKLIGDKAV 135 RKLMVF+AV+I MF + GSLGPRYAP+STNQVYNGIGKLIGDKAV Sbjct: 358 RKLMVFSAVIISMFFIFGSLGPRYAPESTNQVYNGIGKLIGDKAV 402 >XP_007708486.1 hypothetical protein COCCADRAFT_86089 [Bipolaris zeicola 26-R-13] XP_014557859.1 hypothetical protein COCVIDRAFT_95970 [Bipolaris victoriae FI3] EUC37248.1 hypothetical protein COCCADRAFT_86089 [Bipolaris zeicola 26-R-13] EUN28264.1 hypothetical protein COCVIDRAFT_95970 [Bipolaris victoriae FI3] Length = 402 Score = 82.0 bits (201), Expect = 2e-15 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = +1 Query: 1 RKLMVFAAVVIGMFLVLGSLGPRYAPDSTNQVYNGIGKLIGDKAV 135 RKLMVF AV+I MF + GSLGPRYAP+STNQVYNGIGKLIGDKAV Sbjct: 358 RKLMVFTAVIISMFFIFGSLGPRYAPESTNQVYNGIGKLIGDKAV 402 >KNG45334.1 duf250 domain-containing membrane protein [Stemphylium lycopersici] Length = 570 Score = 81.6 bits (200), Expect = 3e-15 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 RKLMVFAAVVIGMFLVLGSLGPRYAPDSTNQVYNGIGKLI 120 RKLMVFAAVVIGMFLVLGSLGPRYAPDSTNQVYNGIGKLI Sbjct: 357 RKLMVFAAVVIGMFLVLGSLGPRYAPDSTNQVYNGIGKLI 396 >OAL43888.1 TPT-domain-containing protein [Pyrenochaeta sp. DS3sAY3a] Length = 402 Score = 80.1 bits (196), Expect = 9e-15 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = +1 Query: 1 RKLMVFAAVVIGMFLVLGSLGPRYAPDSTNQVYNGIGKLIGDKAV 135 RKLMVFAAV+I MF++LGSLGPRYAPDST++VYNG+GKLIG+K V Sbjct: 358 RKLMVFAAVIISMFMILGSLGPRYAPDSTDKVYNGLGKLIGEKGV 402 >XP_003305836.1 hypothetical protein PTT_18786 [Pyrenophora teres f. teres 0-1] EFQ86069.1 hypothetical protein PTT_18786 [Pyrenophora teres f. teres 0-1] Length = 402 Score = 80.1 bits (196), Expect = 9e-15 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 1 RKLMVFAAVVIGMFLVLGSLGPRYAPDSTNQVYNGIGKLIGDKAV 135 RKL++F AVVI +F +LGSLGPRYAP+STNQVYNGIGKLIGDKAV Sbjct: 358 RKLIIFTAVVISVFFILGSLGPRYAPNSTNQVYNGIGKLIGDKAV 402 >OAK99392.1 TPT-domain-containing protein [Stagonospora sp. SRC1lsM3a] Length = 402 Score = 75.5 bits (184), Expect = 4e-13 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = +1 Query: 1 RKLMVFAAVVIGMFLVLGSLGPRYAPDSTNQVYNGIGKLIGDKAV 135 RKLM+FAAV++ MF+VLGSLGPRYAPDST + YNG GKLIG+K V Sbjct: 358 RKLMIFAAVIMAMFMVLGSLGPRYAPDSTAKAYNGFGKLIGEKGV 402 >XP_001799951.1 hypothetical protein SNOG_09663 [Parastagonospora nodorum SN15] EAT82928.1 hypothetical protein SNOG_09663 [Parastagonospora nodorum SN15] Length = 402 Score = 75.1 bits (183), Expect = 5e-13 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = +1 Query: 1 RKLMVFAAVVIGMFLVLGSLGPRYAPDSTNQVYNGIGKLIGDKAV 135 RKLM+FAAV++ MF++LGSLGPRYAPD T + YNGIGKLIG+K V Sbjct: 358 RKLMIFAAVIMSMFMILGSLGPRYAPDQTAKAYNGIGKLIGEKGV 402 >XP_003839343.1 hypothetical protein LEMA_P030160.1 [Leptosphaeria maculans JN3] CBX95864.1 hypothetical protein LEMA_P030160.1 [Leptosphaeria maculans JN3] Length = 154 Score = 70.1 bits (170), Expect = 2e-12 Identities = 30/43 (69%), Positives = 39/43 (90%) Frame = +1 Query: 1 RKLMVFAAVVIGMFLVLGSLGPRYAPDSTNQVYNGIGKLIGDK 129 RKLM+F AV+I +F+VLGSLGPRYAP+ T +VY+GIGK+IG+K Sbjct: 110 RKLMIFTAVIISVFMVLGSLGPRYAPEQTGRVYDGIGKIIGEK 152 >XP_018041742.1 TPT-domain-containing protein [Paraphaeosphaeria sporulosa] OAG11377.1 TPT-domain-containing protein [Paraphaeosphaeria sporulosa] Length = 401 Score = 71.2 bits (173), Expect = 1e-11 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = +1 Query: 1 RKLMVFAAVVIGMFLVLGSLGPRYAPDSTNQVYNGIGKLIGDKAV 135 RKLM+F V+I FLV+GSLGPRYAPDS +++YNGIG +IGDK V Sbjct: 357 RKLMIFGGVIISFFLVIGSLGPRYAPDSADKLYNGIGNMIGDKQV 401 >KZM23508.1 integral component of membrane [Ascochyta rabiei] Length = 407 Score = 63.9 bits (154), Expect = 4e-09 Identities = 30/47 (63%), Positives = 37/47 (78%), Gaps = 4/47 (8%) Frame = +1 Query: 1 RKLMVFAAVVIGMFLVLGSLGPRYAPDSTNQVY----NGIGKLIGDK 129 RKLMVF AVV+ MF +LGSLGPRYAPD T ++Y NGIG ++G+K Sbjct: 359 RKLMVFGAVVVSMFFILGSLGPRYAPDQTGKLYNGVQNGIGHVLGEK 405