BLASTX nr result
ID: Panax25_contig00052229
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00052229 (414 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KCW51607.1 hypothetical protein EUGRSUZ_J01097 [Eucalyptus grandis] 53 3e-06 ERN04997.1 hypothetical protein AMTR_s05400p00003230 [Amborella ... 54 4e-06 >KCW51607.1 hypothetical protein EUGRSUZ_J01097 [Eucalyptus grandis] Length = 117 Score = 52.8 bits (125), Expect = 3e-06 Identities = 26/58 (44%), Positives = 35/58 (60%) Frame = -3 Query: 382 IEPIYLRLALLTRSPFGLVAFGLKYGVKRFSTLARLGGAGYRVAGSCGRKLSRRRERI 209 + PI ++ + + P G++A LKYG+KRFSTLA + GAGYRV S ERI Sbjct: 5 LSPISIKSLMNSHHPCGIMAIHLKYGIKRFSTLAHISGAGYRVLAKLDHIGSTHTERI 62 >ERN04997.1 hypothetical protein AMTR_s05400p00003230 [Amborella trichopoda] Length = 223 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/82 (36%), Positives = 44/82 (53%), Gaps = 4/82 (4%) Frame = -3 Query: 412 RFWVRGGNIYIEPIYLRLALLTRSPFGLVAFGLKYGVKRFSTLARLGGAGYR----VAGS 245 RF +R G + I PI +R L P+GL+A K VKRF+TL R+GG GY+ G Sbjct: 66 RFRIRRGTVDISPISIRALLSYSHPYGLMAINHKSNVKRFTTLLRIGGFGYKGQPLTPGL 125 Query: 244 CGRKLSRRRERIRAKELLFRPD 179 G+ + ++ K++ PD Sbjct: 126 RGKLIQLVLNKLSPKDIQIAPD 147