BLASTX nr result
ID: Panax25_contig00052136
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00052136 (371 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KFK24299.1 hypothetical protein AALP_AAs68702U000100 [Arabis alp... 70 7e-14 YP_173450.1 hypothetical protein NitaMp112 [Nicotiana tabacum] B... 63 4e-10 >KFK24299.1 hypothetical protein AALP_AAs68702U000100 [Arabis alpina] Length = 58 Score = 70.5 bits (171), Expect = 7e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 305 QHNSVPRLRFIPATVVYGSKRLVPSGANPLHH 210 QHNSVPRLRFIPATVVYGSKRLVPSGANPLHH Sbjct: 27 QHNSVPRLRFIPATVVYGSKRLVPSGANPLHH 58 >YP_173450.1 hypothetical protein NitaMp112 [Nicotiana tabacum] BAD83515.1 hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 129 Score = 62.8 bits (151), Expect = 4e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 305 QHNSVPRLRFIPATVVYGSKRLVPSGANPLHH 210 +HNSVP+LRFIPATVVYGSKR VPSGANPLH+ Sbjct: 98 KHNSVPKLRFIPATVVYGSKRRVPSGANPLHN 129