BLASTX nr result
ID: Panax25_contig00052054
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00052054 (366 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016565389.1 PREDICTED: zinc finger HIT domain-containing prot... 55 3e-06 XP_015083953.1 PREDICTED: zinc finger HIT domain-containing prot... 55 3e-06 XP_006343799.1 PREDICTED: zinc finger HIT domain-containing prot... 55 3e-06 XP_004245472.1 PREDICTED: zinc finger HIT domain-containing prot... 55 3e-06 XP_016176822.1 PREDICTED: zinc finger HIT domain-containing prot... 54 4e-06 XP_015939229.1 PREDICTED: zinc finger HIT domain-containing prot... 54 4e-06 XP_011070368.1 PREDICTED: zinc finger HIT domain-containing prot... 54 4e-06 OAY56295.1 hypothetical protein MANES_02G004600 [Manihot esculenta] 54 6e-06 OMO79854.1 Zinc finger, HIT-type [Corchorus capsularis] 54 6e-06 OMP02861.1 SHQ1 protein [Corchorus olitorius] 54 7e-06 >XP_016565389.1 PREDICTED: zinc finger HIT domain-containing protein 2 [Capsicum annuum] Length = 409 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 247 QISFDDLSADEKKRFQRAVASGELSSLI*PLEPY 348 QISF+DLSA+EKK FQRAVASGELS LI P EP+ Sbjct: 119 QISFEDLSAEEKKHFQRAVASGELSKLIKPWEPW 152 >XP_015083953.1 PREDICTED: zinc finger HIT domain-containing protein 2 [Solanum pennellii] Length = 409 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 247 QISFDDLSADEKKRFQRAVASGELSSLI*PLEPY 348 QISF+DLSA+EKK FQRAVASGELS LI P EP+ Sbjct: 119 QISFEDLSAEEKKHFQRAVASGELSKLIKPWEPW 152 >XP_006343799.1 PREDICTED: zinc finger HIT domain-containing protein 2 [Solanum tuberosum] Length = 409 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 247 QISFDDLSADEKKRFQRAVASGELSSLI*PLEPY 348 QISF+DLSA+EKK FQRAVASGELS LI P EP+ Sbjct: 119 QISFEDLSAEEKKHFQRAVASGELSKLIKPWEPW 152 >XP_004245472.1 PREDICTED: zinc finger HIT domain-containing protein 2 [Solanum lycopersicum] Length = 409 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 247 QISFDDLSADEKKRFQRAVASGELSSLI*PLEPY 348 QISF+DLSA+EKK FQRAVASGELS LI P EP+ Sbjct: 119 QISFEDLSAEEKKHFQRAVASGELSKLIKPWEPW 152 >XP_016176822.1 PREDICTED: zinc finger HIT domain-containing protein 2 [Arachis ipaensis] Length = 407 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +1 Query: 247 QISFDDLSADEKKRFQRAVASGELSSLI*PLEPY 348 +ISFDDLS +EKKRFQRA+ASGELS +I P EP+ Sbjct: 120 EISFDDLSVEEKKRFQRAIASGELSKMIKPWEPW 153 >XP_015939229.1 PREDICTED: zinc finger HIT domain-containing protein 2 [Arachis duranensis] Length = 407 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +1 Query: 247 QISFDDLSADEKKRFQRAVASGELSSLI*PLEPY 348 +ISFDDLS +EKKRFQRA+ASGELS +I P EP+ Sbjct: 120 EISFDDLSVEEKKRFQRAIASGELSKMIKPWEPW 153 >XP_011070368.1 PREDICTED: zinc finger HIT domain-containing protein 2 [Sesamum indicum] XP_011070369.1 PREDICTED: zinc finger HIT domain-containing protein 2 [Sesamum indicum] Length = 412 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 247 QISFDDLSADEKKRFQRAVASGELSSLI*PLEPY 348 QISFDDLS +EKKRFQRAVA+GELS LI P +P+ Sbjct: 121 QISFDDLSVEEKKRFQRAVATGELSKLIEPWDPW 154 >OAY56295.1 hypothetical protein MANES_02G004600 [Manihot esculenta] Length = 409 Score = 53.9 bits (128), Expect = 6e-06 Identities = 31/49 (63%), Positives = 34/49 (69%), Gaps = 7/49 (14%) Frame = +1 Query: 223 CLLFSTIVQ-------ISFDDLSADEKKRFQRAVASGELSSLI*PLEPY 348 CLL VQ ISFDDLSA+EKK FQRAVASGELS LI P +P+ Sbjct: 107 CLLSEETVQKILSGGSISFDDLSAEEKKLFQRAVASGELSKLIEPWDPW 155 >OMO79854.1 Zinc finger, HIT-type [Corchorus capsularis] Length = 929 Score = 53.9 bits (128), Expect = 6e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 247 QISFDDLSADEKKRFQRAVASGELSSLI*PLEPY 348 ++SFDDLS +EKKRFQRAVASGELS+LI P +P+ Sbjct: 639 EVSFDDLSLEEKKRFQRAVASGELSNLIEPWDPW 672 >OMP02861.1 SHQ1 protein [Corchorus olitorius] Length = 350 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +1 Query: 247 QISFDDLSADEKKRFQRAVASGELSSLI*PLEPY 348 ++SFDDLS +EKKRFQRAVASGELS LI P +P+ Sbjct: 113 EVSFDDLSLEEKKRFQRAVASGELSKLIEPWDPW 146