BLASTX nr result
ID: Panax25_contig00052000
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00052000 (355 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAN76993.1 hypothetical protein VITISV_043346 [Vitis vinifera] 70 1e-12 KZM90636.1 hypothetical protein DCAR_021999 [Daucus carota subsp... 72 2e-12 XP_017256191.1 PREDICTED: cyclin-D3-1-like [Daucus carota subsp.... 72 3e-12 XP_002510161.1 PREDICTED: cyclin-D3-3 [Ricinus communis] EEF5234... 71 5e-12 CBI40278.3 unnamed protein product, partial [Vitis vinifera] 70 7e-12 XP_002285320.1 PREDICTED: cyclin-D3-3 [Vitis vinifera] 70 7e-12 XP_018805435.1 PREDICTED: cyclin-D3-2-like [Juglans regia] 69 2e-11 OAY22976.1 hypothetical protein MANES_18G041600 [Manihot esculenta] 69 2e-11 XP_010270923.1 PREDICTED: cyclin-D3-1-like [Nelumbo nucifera] 69 2e-11 XP_012068292.1 PREDICTED: cyclin-D3-3-like [Jatropha curcas] KDP... 69 2e-11 XP_019165658.1 PREDICTED: cyclin-D3-1-like [Ipomoea nil] 69 2e-11 AAQ19973.1 cyclin D3-1 [Euphorbia esula] 69 2e-11 OMO78863.1 hypothetical protein CCACVL1_14056 [Corchorus capsula... 69 3e-11 BAE80324.1 cyclin D3-1 [Camellia sinensis] 68 5e-11 XP_018845028.1 PREDICTED: cyclin-D3-2 isoform X2 [Juglans regia] 68 5e-11 BAE06272.1 cyclin D [Scutellaria baicalensis] 68 5e-11 XP_018845027.1 PREDICTED: cyclin-D3-2 isoform X1 [Juglans regia] 68 5e-11 XP_006425979.1 hypothetical protein CICLE_v10025890mg [Citrus cl... 67 6e-11 OAY50975.1 hypothetical protein MANES_05G177400 [Manihot esculenta] 68 6e-11 AAN87006.1 cyclin D, partial [Populus alba] 67 6e-11 >CAN76993.1 hypothetical protein VITISV_043346 [Vitis vinifera] Length = 156 Score = 69.7 bits (169), Expect = 1e-12 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +1 Query: 226 WLCFLIQ*VEDSKYVFEAKTIQRMELLVMSTLQWRMNPVTPLS 354 WL FLI VED +YVFEAKTIQRM+ LV+STLQW+MNPVTPLS Sbjct: 27 WLPFLIH-VEDXEYVFEAKTIQRMDFLVLSTLQWKMNPVTPLS 68 >KZM90636.1 hypothetical protein DCAR_021999 [Daucus carota subsp. sativus] Length = 342 Score = 71.6 bits (174), Expect = 2e-12 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 250 VEDSKYVFEAKTIQRMELLVMSTLQWRMNPVTPLS 354 VEDSKYVFEAKTIQRMELLVMSTL+WRMNPVTPLS Sbjct: 156 VEDSKYVFEAKTIQRMELLVMSTLEWRMNPVTPLS 190 >XP_017256191.1 PREDICTED: cyclin-D3-1-like [Daucus carota subsp. sativus] Length = 352 Score = 71.6 bits (174), Expect = 3e-12 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 250 VEDSKYVFEAKTIQRMELLVMSTLQWRMNPVTPLS 354 VEDSKYVFEAKTIQRMELLVMSTL+WRMNPVTPLS Sbjct: 156 VEDSKYVFEAKTIQRMELLVMSTLEWRMNPVTPLS 190 >XP_002510161.1 PREDICTED: cyclin-D3-3 [Ricinus communis] EEF52348.1 cyclin d, putative [Ricinus communis] Length = 378 Score = 70.9 bits (172), Expect = 5e-12 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 250 VEDSKYVFEAKTIQRMELLVMSTLQWRMNPVTPLS 354 VEDSKYVFEAKTIQRME+LV+STLQWRMNPVTPLS Sbjct: 181 VEDSKYVFEAKTIQRMEILVLSTLQWRMNPVTPLS 215 >CBI40278.3 unnamed protein product, partial [Vitis vinifera] Length = 374 Score = 70.5 bits (171), Expect = 7e-12 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 250 VEDSKYVFEAKTIQRMELLVMSTLQWRMNPVTPLS 354 VEDSKYVFEAKTIQRMELLV+STLQW+MNPVTPLS Sbjct: 168 VEDSKYVFEAKTIQRMELLVLSTLQWKMNPVTPLS 202 >XP_002285320.1 PREDICTED: cyclin-D3-3 [Vitis vinifera] Length = 386 Score = 70.5 bits (171), Expect = 7e-12 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 250 VEDSKYVFEAKTIQRMELLVMSTLQWRMNPVTPLS 354 VEDSKYVFEAKTIQRMELLV+STLQW+MNPVTPLS Sbjct: 180 VEDSKYVFEAKTIQRMELLVLSTLQWKMNPVTPLS 214 >XP_018805435.1 PREDICTED: cyclin-D3-2-like [Juglans regia] Length = 364 Score = 69.3 bits (168), Expect = 2e-11 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +1 Query: 250 VEDSKYVFEAKTIQRMELLVMSTLQWRMNPVTPLS 354 VE+SKYVFEAKTIQRMELLV+STLQWRMNPVTP+S Sbjct: 167 VEESKYVFEAKTIQRMELLVLSTLQWRMNPVTPIS 201 >OAY22976.1 hypothetical protein MANES_18G041600 [Manihot esculenta] Length = 373 Score = 69.3 bits (168), Expect = 2e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 250 VEDSKYVFEAKTIQRMELLVMSTLQWRMNPVTPLS 354 VEDS+YVFEAKTIQRME+LV+STLQWRMNP+TPLS Sbjct: 177 VEDSRYVFEAKTIQRMEILVLSTLQWRMNPITPLS 211 >XP_010270923.1 PREDICTED: cyclin-D3-1-like [Nelumbo nucifera] Length = 379 Score = 69.3 bits (168), Expect = 2e-11 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +1 Query: 250 VEDSKYVFEAKTIQRMELLVMSTLQWRMNPVTPLS 354 VED+KYVFEAKTIQRMELLV+STLQW+MNPVTPLS Sbjct: 176 VEDTKYVFEAKTIQRMELLVLSTLQWKMNPVTPLS 210 >XP_012068292.1 PREDICTED: cyclin-D3-3-like [Jatropha curcas] KDP41686.1 hypothetical protein JCGZ_16093 [Jatropha curcas] Length = 390 Score = 69.3 bits (168), Expect = 2e-11 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +1 Query: 250 VEDSKYVFEAKTIQRMELLVMSTLQWRMNPVTPLS 354 VEDSKYVFEAKTIQRME+LV+STL+WRMNPVTPLS Sbjct: 191 VEDSKYVFEAKTIQRMEILVLSTLRWRMNPVTPLS 225 >XP_019165658.1 PREDICTED: cyclin-D3-1-like [Ipomoea nil] Length = 342 Score = 68.9 bits (167), Expect = 2e-11 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +1 Query: 250 VEDSKYVFEAKTIQRMELLVMSTLQWRMNPVTPLS 354 VED+KYVFEAKTIQRMELLV+STL+WRMNPVTPLS Sbjct: 161 VEDAKYVFEAKTIQRMELLVLSTLKWRMNPVTPLS 195 >AAQ19973.1 cyclin D3-1 [Euphorbia esula] Length = 350 Score = 68.9 bits (167), Expect = 2e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 250 VEDSKYVFEAKTIQRMELLVMSTLQWRMNPVTPLS 354 V DSKYVFEAKTIQRMELLV+STLQWRMNPVTPLS Sbjct: 156 VVDSKYVFEAKTIQRMELLVLSTLQWRMNPVTPLS 190 >OMO78863.1 hypothetical protein CCACVL1_14056 [Corchorus capsularis] Length = 364 Score = 68.6 bits (166), Expect = 3e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 250 VEDSKYVFEAKTIQRMELLVMSTLQWRMNPVTPLS 354 VEDS+YVFEAKTIQRME+LV+STLQW+MNPVTPLS Sbjct: 168 VEDSRYVFEAKTIQRMEILVLSTLQWKMNPVTPLS 202 >BAE80324.1 cyclin D3-1 [Camellia sinensis] Length = 371 Score = 68.2 bits (165), Expect = 5e-11 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +1 Query: 250 VEDSKYVFEAKTIQRMELLVMSTLQWRMNPVTPLS 354 VEDS+YVFEAKTIQRME+L++STLQW+MNPVTPLS Sbjct: 173 VEDSRYVFEAKTIQRMEMLILSTLQWKMNPVTPLS 207 >XP_018845028.1 PREDICTED: cyclin-D3-2 isoform X2 [Juglans regia] Length = 372 Score = 68.2 bits (165), Expect = 5e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 250 VEDSKYVFEAKTIQRMELLVMSTLQWRMNPVTPLS 354 VE+SKYVFEA+TIQRMELLV+STLQWRMNPVTP+S Sbjct: 167 VEESKYVFEARTIQRMELLVLSTLQWRMNPVTPMS 201 >BAE06272.1 cyclin D [Scutellaria baicalensis] Length = 372 Score = 68.2 bits (165), Expect = 5e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 250 VEDSKYVFEAKTIQRMELLVMSTLQWRMNPVTPLS 354 VE+SKY+FEAKTIQRMELLV+STLQWRMNPVTP+S Sbjct: 169 VEESKYLFEAKTIQRMELLVLSTLQWRMNPVTPIS 203 >XP_018845027.1 PREDICTED: cyclin-D3-2 isoform X1 [Juglans regia] Length = 373 Score = 68.2 bits (165), Expect = 5e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 250 VEDSKYVFEAKTIQRMELLVMSTLQWRMNPVTPLS 354 VE+SKYVFEA+TIQRMELLV+STLQWRMNPVTP+S Sbjct: 167 VEESKYVFEARTIQRMELLVLSTLQWRMNPVTPMS 201 >XP_006425979.1 hypothetical protein CICLE_v10025890mg [Citrus clementina] ESR39219.1 hypothetical protein CICLE_v10025890mg [Citrus clementina] Length = 282 Score = 67.4 bits (163), Expect = 6e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 250 VEDSKYVFEAKTIQRMELLVMSTLQWRMNPVTPLS 354 V+D KYVFEAKTIQRMELLV+STLQWRMNPVTP+S Sbjct: 168 VKDPKYVFEAKTIQRMELLVLSTLQWRMNPVTPIS 202 >OAY50975.1 hypothetical protein MANES_05G177400 [Manihot esculenta] Length = 335 Score = 67.8 bits (164), Expect = 6e-11 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +1 Query: 250 VEDSKYVFEAKTIQRMELLVMSTLQWRMNPVTPLS 354 VE+S+YVFEAKTIQRME+LV+STLQWRMNP+TPLS Sbjct: 139 VEESRYVFEAKTIQRMEILVLSTLQWRMNPITPLS 173 >AAN87006.1 cyclin D, partial [Populus alba] Length = 289 Score = 67.4 bits (163), Expect = 6e-11 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +1 Query: 250 VEDSKYVFEAKTIQRMELLVMSTLQWRMNPVTPLS 354 VEDSKYVFEAKTIQRME+LV+STL+W+MNPVTP+S Sbjct: 146 VEDSKYVFEAKTIQRMEILVLSTLKWKMNPVTPIS 180