BLASTX nr result
ID: Panax25_contig00050338
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00050338 (423 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017232080.1 PREDICTED: homeobox protein BEL1 homolog [Daucus ... 55 3e-06 >XP_017232080.1 PREDICTED: homeobox protein BEL1 homolog [Daucus carota subsp. sativus] XP_017232081.1 PREDICTED: homeobox protein BEL1 homolog [Daucus carota subsp. sativus] XP_017232082.1 PREDICTED: homeobox protein BEL1 homolog [Daucus carota subsp. sativus] KZN06888.1 hypothetical protein DCAR_007725 [Daucus carota subsp. sativus] Length = 587 Score = 55.5 bits (132), Expect = 3e-06 Identities = 25/49 (51%), Positives = 30/49 (61%) Frame = -2 Query: 149 MDKDVFSVPIDMAYQNPIITSGKISHSTSVSLIHMYSDDLNEQNQIMAG 3 MD D+F VP D YQNP+ SG + ST S + + DL QNQIMAG Sbjct: 1 MDNDIFGVPADTVYQNPVAGSGNVLSSTLFSFLQSHPHDLTNQNQIMAG 49