BLASTX nr result
ID: Panax25_contig00049265
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00049265 (555 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_007026589.1 ribosomal protein L14 [Festuca ovina] AFV62769.1 ... 68 2e-11 YP_009339378.1 ribosomal protein L14 (plastid) [Cyanea fissa] AP... 67 3e-11 AIA24253.1 ribosomal protein S14, partial (plastid) [Oldeania al... 66 3e-11 YP_009266458.1 ribosomal protein L14 (chloroplast) [Oryza brachy... 67 6e-11 YP_009233813.1 ribosomal protein L14 (plastid) [Bouteloua curtip... 67 6e-11 YP_009157077.1 ribosomal protein L14 (plastid) [Melica subulata]... 67 6e-11 AIQ79237.1 ribosomal protein L14 (plastid) [Chaetobromus involuc... 67 6e-11 ANX10420.1 ribosomal protein L14 (plastid) [Kuruna densifolia] 66 7e-11 ABJ52167.1 ribosomal protein L14, partial (chloroplast) [Phyllos... 66 8e-11 APD27786.1 ribosomal protein L14 (chloroplast) [Alloteropsis ang... 66 8e-11 YP_009260437.1 ribosomal protein L14 (chloroplast) [Oplismenus h... 66 8e-11 YP_009261350.1 ribosomal protein L14 (chloroplast) [Danthoniopsi... 66 8e-11 YP_009246058.1 ribosomal protein L14 (plastid) [Distichlis bajae... 66 8e-11 YP_009166546.1 ribosomal protein L14 (chloroplast) [Alloteropsis... 66 8e-11 YP_009160487.1 ribosomal protein L14 (chloroplast) [Sporobolus m... 66 8e-11 BAD33446.1 putative ribosomal protein L14 [Oryza sativa Japonica... 66 8e-11 NP_114294.1 ribosomal protein L14 (chloroplast) [Triticum aestiv... 66 8e-11 YP_009157495.1 ribosomal protein L14 (plastid) [Piptochaetium av... 66 8e-11 YP_009141113.1 ribosomal protein L14 (chloroplast) [Sartidia per... 66 8e-11 YP_009135478.1 ribosomal protein L14 (plastid) [Olmeca reflexa] ... 66 8e-11 >YP_007026589.1 ribosomal protein L14 [Festuca ovina] AFV62769.1 ribosomal protein L14 (plastid) [Festuca ovina] Length = 123 Score = 67.8 bits (164), Expect = 2e-11 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 228 MSLERSEVIRNLM*LACKEFKCCHDMIIRYDDNTAIVIDQ*GNPR*TLVFVTIS*E 61 M LERSEVIR ++ CKEFKC +IIRYDDN A++IDQ GNP+ T VF I+ E Sbjct: 51 MPLERSEVIRAVIVRTCKEFKCADGIIIRYDDNAAVIIDQKGNPKGTRVFGAIAEE 106 >YP_009339378.1 ribosomal protein L14 (plastid) [Cyanea fissa] APQ38770.1 ribosomal protein L14 (plastid) [Cyanea fissa] Length = 122 Score = 67.4 bits (163), Expect = 3e-11 Identities = 35/56 (62%), Positives = 41/56 (73%) Frame = -1 Query: 228 MSLERSEVIRNLM*LACKEFKCCHDMIIRYDDNTAIVIDQ*GNPR*TLVFVTIS*E 61 MSLERSEV+R ++ CKE KC MIIRYDDN A+VID+ GNP+ T VF IS E Sbjct: 50 MSLERSEVVRAVIVRTCKELKCDDGMIIRYDDNAAVVIDKEGNPKGTRVFGAISEE 105 >AIA24253.1 ribosomal protein S14, partial (plastid) [Oldeania alpina] Length = 88 Score = 66.2 bits (160), Expect = 3e-11 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 228 MSLERSEVIRNLM*LACKEFKCCHDMIIRYDDNTAIVIDQ*GNPR*TLVFVTIS*E 61 M LERSEVIR ++ CKEFKC +IIRYDDN A++IDQ GNP+ T VF I+ E Sbjct: 16 MPLERSEVIRAVIVRTCKEFKCEDGIIIRYDDNAAVIIDQKGNPKGTRVFGAIAEE 71 >YP_009266458.1 ribosomal protein L14 (chloroplast) [Oryza brachyantha] ANJ78545.1 ribosomal protein L14 (chloroplast) [Oryza brachyantha] Length = 123 Score = 66.6 bits (161), Expect = 6e-11 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 228 MSLERSEVIRNLM*LACKEFKCCHDMIIRYDDNTAIVIDQ*GNPR*TLVFVTIS*E 61 M LERSEVIR ++ CKEFKC +IIRYDDN A++IDQ GNP+ T VF I+ E Sbjct: 51 MPLERSEVIRAVIVRTCKEFKCKDGIIIRYDDNAAVIIDQKGNPKGTRVFGAIAEE 106 >YP_009233813.1 ribosomal protein L14 (plastid) [Bouteloua curtipendula] AMB49509.1 ribosomal protein L14 (plastid) [Bouteloua curtipendula] Length = 123 Score = 66.6 bits (161), Expect = 6e-11 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 228 MSLERSEVIRNLM*LACKEFKCCHDMIIRYDDNTAIVIDQ*GNPR*TLVFVTIS*E 61 M LERSEVIR ++ CKEFKC +IIRYDDN A++IDQ GNP+ T VF I+ E Sbjct: 51 MPLERSEVIRAVIVRTCKEFKCKDGIIIRYDDNAAVIIDQKGNPKGTRVFGAIAEE 106 >YP_009157077.1 ribosomal protein L14 (plastid) [Melica subulata] YP_009180522.1 ribosomal protein L14 (chloroplast) [Stipa lipskyi] YP_009232696.1 ribosomal protein L14 (chloroplast) [Stipa purpurea] AJV89984.1 ribosomal protein L14 (plastid) [Melica subulata] ALM03014.1 ribosomal protein L14 (chloroplast) [Stipa lipskyi] AMA97134.1 ribosomal protein L14 (chloroplast) [Stipa purpurea] Length = 123 Score = 66.6 bits (161), Expect = 6e-11 Identities = 35/56 (62%), Positives = 41/56 (73%) Frame = -1 Query: 228 MSLERSEVIRNLM*LACKEFKCCHDMIIRYDDNTAIVIDQ*GNPR*TLVFVTIS*E 61 M LERSEVIR ++ CKEFKC +IIRYDDN A+VIDQ GNP+ T VF I+ E Sbjct: 51 MPLERSEVIRAVIVRTCKEFKCEDGIIIRYDDNAAVVIDQKGNPKGTRVFGAIAEE 106 >AIQ79237.1 ribosomal protein L14 (plastid) [Chaetobromus involucratus subsp. dregeanus] Length = 123 Score = 66.6 bits (161), Expect = 6e-11 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 228 MSLERSEVIRNLM*LACKEFKCCHDMIIRYDDNTAIVIDQ*GNPR*TLVFVTIS*E 61 M LERSEVIR ++ CKEFKC +IIRYDDN A++IDQ GNP+ T VF I+ E Sbjct: 51 MPLERSEVIRAVIVRTCKEFKCNDGIIIRYDDNAAVIIDQKGNPKGTRVFGAIAEE 106 >ANX10420.1 ribosomal protein L14 (plastid) [Kuruna densifolia] Length = 117 Score = 66.2 bits (160), Expect = 7e-11 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 228 MSLERSEVIRNLM*LACKEFKCCHDMIIRYDDNTAIVIDQ*GNPR*TLVFVTIS*E 61 M LERSEVIR ++ CKEFKC +IIRYDDN A++IDQ GNP+ T VF I+ E Sbjct: 51 MPLERSEVIRAVIVRTCKEFKCEDGIIIRYDDNAAVIIDQKGNPKGTRVFGAIARE 106 >ABJ52167.1 ribosomal protein L14, partial (chloroplast) [Phyllostachys edulis] Length = 122 Score = 66.2 bits (160), Expect = 8e-11 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 228 MSLERSEVIRNLM*LACKEFKCCHDMIIRYDDNTAIVIDQ*GNPR*TLVFVTIS*E 61 M LERSEVIR ++ CKEFKC +IIRYDDN A++IDQ GNP+ T VF I+ E Sbjct: 51 MPLERSEVIRAVIVRTCKEFKCEDGIIIRYDDNAAVIIDQKGNPKGTRVFGAIAEE 106 >APD27786.1 ribosomal protein L14 (chloroplast) [Alloteropsis angusta] Length = 123 Score = 66.2 bits (160), Expect = 8e-11 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 228 MSLERSEVIRNLM*LACKEFKCCHDMIIRYDDNTAIVIDQ*GNPR*TLVFVTIS*E 61 M LERSEVIR ++ CKEFKC +IIRYDDN A++IDQ GNP+ T VF I+ E Sbjct: 51 MPLERSEVIRAVIIRTCKEFKCEDGIIIRYDDNAAVIIDQKGNPKGTRVFGAIAEE 106 >YP_009260437.1 ribosomal protein L14 (chloroplast) [Oplismenus hirtellus] ANN36644.1 ribosomal protein L14 (chloroplast) [Oplismenus hirtellus] Length = 123 Score = 66.2 bits (160), Expect = 8e-11 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 228 MSLERSEVIRNLM*LACKEFKCCHDMIIRYDDNTAIVIDQ*GNPR*TLVFVTIS*E 61 M LERSEVIR ++ CKEFKC +IIRYDDN A++IDQ GNP+ T VF I+ E Sbjct: 51 MPLERSEVIRAVIVRTCKEFKCEDGIIIRYDDNAAVIIDQKGNPKGTRVFGAIAEE 106 >YP_009261350.1 ribosomal protein L14 (chloroplast) [Danthoniopsis dinteri] YP_009267099.1 ribosomal protein L14 (chloroplast) [Loudetiopsis kerstingii] ANN36312.1 ribosomal protein L14 (chloroplast) [Loudetiopsis kerstingii] ANN38470.1 ribosomal protein L14 (chloroplast) [Danthoniopsis dinteri] Length = 123 Score = 66.2 bits (160), Expect = 8e-11 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 228 MSLERSEVIRNLM*LACKEFKCCHDMIIRYDDNTAIVIDQ*GNPR*TLVFVTIS*E 61 M LERSEVIR ++ CKEFKC +IIRYDDN A++IDQ GNP+ T VF I+ E Sbjct: 51 MPLERSEVIRAVIVRTCKEFKCEDGIIIRYDDNAAVIIDQKGNPKGTRVFGAIAEE 106 >YP_009246058.1 ribosomal protein L14 (plastid) [Distichlis bajaensis] AMB35956.1 ribosomal protein L14 (plastid) [Distichlis bajaensis] Length = 123 Score = 66.2 bits (160), Expect = 8e-11 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 228 MSLERSEVIRNLM*LACKEFKCCHDMIIRYDDNTAIVIDQ*GNPR*TLVFVTIS*E 61 M LERSEVIR ++ CKEFKC +IIRYDDN A++IDQ GNP+ T VF I+ E Sbjct: 51 MPLERSEVIRAVIVRTCKEFKCEDGIIIRYDDNAAVIIDQKGNPKGTRVFGAIAEE 106 >YP_009166546.1 ribosomal protein L14 (chloroplast) [Alloteropsis cimicina] YP_009328165.1 ribosomal protein L14 (chloroplast) [Alloteropsis paniculata] ALB38054.1 ribosomal protein L14 (chloroplast) [Alloteropsis cimicina] APD27703.1 ribosomal protein L14 (chloroplast) [Alloteropsis paniculata] Length = 123 Score = 66.2 bits (160), Expect = 8e-11 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 228 MSLERSEVIRNLM*LACKEFKCCHDMIIRYDDNTAIVIDQ*GNPR*TLVFVTIS*E 61 M LERSEVIR ++ CKEFKC +IIRYDDN A++IDQ GNP+ T VF I+ E Sbjct: 51 MPLERSEVIRAVIVRTCKEFKCEDGIIIRYDDNAAVIIDQKGNPKGTRVFGAIAEE 106 >YP_009160487.1 ribosomal protein L14 (chloroplast) [Sporobolus maritimus] YP_009233983.1 ribosomal protein L14 (plastid) [Sporobolus michauxianus] YP_009234068.1 ribosomal protein L14 (plastid) [Sporobolus heterolepis] YP_009234153.1 ribosomal protein L14 (plastid) [Zoysia macrantha] AKB92880.1 ribosomal protein L14 (chloroplast) [Sporobolus maritimus] AMB49679.1 ribosomal protein L14 (plastid) [Sporobolus michauxianus] AMB49764.1 ribosomal protein L14 (plastid) [Sporobolus heterolepis] AMB49849.1 ribosomal protein L14 (plastid) [Zoysia macrantha] BAV38077.1 ribosomal protein L14 (chloroplast) [Zoysia matrella] Length = 123 Score = 66.2 bits (160), Expect = 8e-11 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 228 MSLERSEVIRNLM*LACKEFKCCHDMIIRYDDNTAIVIDQ*GNPR*TLVFVTIS*E 61 M LERSEVIR ++ CKEFKC +IIRYDDN A++IDQ GNP+ T VF I+ E Sbjct: 51 MPLERSEVIRAVIVRTCKEFKCEDGIIIRYDDNAAVIIDQKGNPKGTRVFGAIAEE 106 >BAD33446.1 putative ribosomal protein L14 [Oryza sativa Japonica Group] BAD33722.1 putative ribosomal protein L14 [Oryza sativa Japonica Group] Length = 123 Score = 66.2 bits (160), Expect = 8e-11 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 228 MSLERSEVIRNLM*LACKEFKCCHDMIIRYDDNTAIVIDQ*GNPR*TLVFVTIS*E 61 M LERSEVIR ++ CKEFKC +IIRYDDN A++IDQ GNP+ T VF I+ E Sbjct: 51 MPLERSEVIRAVIVRTCKEFKCEDGIIIRYDDNAAVIIDQKGNPKGTRVFGAIAEE 106 >NP_114294.1 ribosomal protein L14 (chloroplast) [Triticum aestivum] YP_008474427.1 ribosomal protein L14 (chloroplast) [Aegilops speltoides] YP_009054872.1 ribosomal protein L14 (chloroplast) [Triticum timopheevii] YP_009057271.1 ribosomal protein L14 (chloroplast) [Triticum turgidum] YP_009112498.1 ribosomal protein L14 (chloroplast) [Triticum macha] Q95H51.1 RecName: Full=50S ribosomal protein L14, chloroplastic BAB47070.1 ribosomal protein L14 (chloroplast) [Triticum aestivum] AFN42409.1 ribosomal protein L14 (chloroplast) [Aegilops speltoides] AGP51319.1 ribosomal protein L14 (chloroplast) [Triticum aestivum] AHN16291.1 ribosomal protein L14 (chloroplast) [Triticum urartu] AIG61205.1 ribosomal protein L14 (chloroplast) [Triticum aestivum] AIG90464.1 ribosomal protein L14 (chloroplast) [Triticum aestivum] AIG90546.1 ribosomal protein L14 (chloroplast) [Triticum turgidum] AIG90628.1 ribosomal protein L14 (chloroplast) [Triticum turgidum] AIG90710.1 ribosomal protein L14 (chloroplast) [Triticum turgidum] AIG90792.1 ribosomal protein L14 (chloroplast) [Triticum turgidum] AIG90874.1 ribosomal protein L14 (chloroplast) [Triticum turgidum] AIG90956.1 ribosomal protein L14 (chloroplast) [Triticum turgidum] AIG91038.1 ribosomal protein L14 (chloroplast) [Triticum aestivum] AIG91120.1 ribosomal protein L14 (chloroplast) [Aegilops speltoides var. ligustica] AIG91202.1 ribosomal protein L14 (chloroplast) [Aegilops speltoides var. ligustica] AIG91284.1 ribosomal protein L14 (chloroplast) [Aegilops speltoides var. speltoides] AIG91366.1 ribosomal protein L14 (chloroplast) [Triticum timopheevii] AIG91448.1 ribosomal protein L14 (chloroplast) [Triticum timopheevii] AIG91530.1 ribosomal protein L14 (chloroplast) [Triticum timopheevii] AIG91611.1 ribosomal protein L14 (chloroplast) [Triticum timopheevii] BAP59071.1 ribosomal protein L14, partial (chloroplast) [Triticum timopheevii] AIU45495.1 ribosomal protein L14 (chloroplast) [Triticum turgidum subsp. durum] BAP91101.1 ribosomal protein L14 (chloroplast) [Triticum macha] Length = 123 Score = 66.2 bits (160), Expect = 8e-11 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 228 MSLERSEVIRNLM*LACKEFKCCHDMIIRYDDNTAIVIDQ*GNPR*TLVFVTIS*E 61 M LERSEVIR ++ CKEFKC +IIRYDDN A++IDQ GNP+ T VF I+ E Sbjct: 51 MPLERSEVIRAVIVRTCKEFKCEDGIIIRYDDNAAVIIDQKGNPKGTRVFGAIAEE 106 >YP_009157495.1 ribosomal protein L14 (plastid) [Piptochaetium avenaceum] AJV90402.1 ribosomal protein L14 (plastid) [Piptochaetium avenaceum] Length = 123 Score = 66.2 bits (160), Expect = 8e-11 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 228 MSLERSEVIRNLM*LACKEFKCCHDMIIRYDDNTAIVIDQ*GNPR*TLVFVTIS*E 61 M LERSEVIR ++ CKEFKC +IIRYDDN A++IDQ GNP+ T VF I+ E Sbjct: 51 MPLERSEVIRAVIVRTCKEFKCEDGIIIRYDDNAAVIIDQKGNPKGTRVFGAIAEE 106 >YP_009141113.1 ribosomal protein L14 (chloroplast) [Sartidia perrieri] YP_009141196.1 ribosomal protein L14 (chloroplast) [Sartidia dewinteri] AIL31694.1 ribosomal protein L14 (chloroplast) [Sartidia perrieri] AIL31777.1 ribosomal protein L14 (chloroplast) [Sartidia dewinteri] Length = 123 Score = 66.2 bits (160), Expect = 8e-11 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 228 MSLERSEVIRNLM*LACKEFKCCHDMIIRYDDNTAIVIDQ*GNPR*TLVFVTIS*E 61 M LERSEVIR ++ CKEFKC +IIRYDDN A++IDQ GNP+ T VF I+ E Sbjct: 51 MPLERSEVIRAVIVRTCKEFKCEDGIIIRYDDNAAVIIDQKGNPKGTRVFGAIAEE 106 >YP_009135478.1 ribosomal protein L14 (plastid) [Olmeca reflexa] YP_009135974.1 ribosomal protein L14 (plastid) [Otatea acuminata] YP_009136774.1 ribosomal protein L14 (plastid) [Guadua weberbaueri] YP_009186527.1 ribosomal protein L14 (plastid) [Otatea glauca] YP_009229249.1 ribosomal protein L14 (chloroplast) [Guadua chacoensis] YP_009240745.1 ribosomal protein L14 (chloroplast) [Guadua angustifolia] AIM53653.1 ribosomal protein L14 (plastid) [Olmeca reflexa] AIM54151.1 ribosomal protein L14 (plastid) [Otatea acuminata] AJA39783.1 ribosomal protein L14 (chloroplast) [Guadua angustifolia] AKE07379.1 ribosomal protein L14 (plastid) [Guadua weberbaueri] AKH04635.1 ribosomal protein L14 (plastid) [Otatea glauca] ALT06417.1 ribosomal protein L14 (chloroplast) [Guadua chacoensis] Length = 123 Score = 66.2 bits (160), Expect = 8e-11 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 228 MSLERSEVIRNLM*LACKEFKCCHDMIIRYDDNTAIVIDQ*GNPR*TLVFVTIS*E 61 M LERSEVIR ++ CKEFKC +IIRYDDN A++IDQ GNP+ T VF I+ E Sbjct: 51 MPLERSEVIRAVIVRTCKEFKCEDGIIIRYDDNAAVIIDQKGNPKGTRVFGAIAEE 106