BLASTX nr result
ID: Panax25_contig00049242
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00049242 (585 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017222233.1 PREDICTED: cation/H(+) antiporter 15-like [Daucus... 106 3e-23 XP_017245867.1 PREDICTED: cation/H(+) antiporter 15-like [Daucus... 96 1e-19 CDO99423.1 unnamed protein product [Coffea canephora] 84 3e-15 XP_012842208.1 PREDICTED: cation/H(+) antiporter 15-like [Erythr... 80 3e-14 EYU33342.1 hypothetical protein MIMGU_mgv1a001430mg [Erythranthe... 80 3e-14 XP_011082524.1 PREDICTED: cation/H(+) antiporter 15-like [Sesamu... 80 6e-14 XP_011096534.1 PREDICTED: cation/H(+) antiporter 15-like [Sesamu... 79 1e-13 XP_019168772.1 PREDICTED: cation/H(+) antiporter 15-like [Ipomoe... 77 4e-13 EPS59090.1 hypothetical protein M569_15718, partial [Genlisea au... 69 2e-10 XP_019189223.1 PREDICTED: cation/H(+) antiporter 15-like [Ipomoe... 69 4e-10 XP_016537581.1 PREDICTED: cation/H(+) antiporter 15-like [Capsic... 68 7e-10 XP_015084045.1 PREDICTED: cation/H(+) antiporter 15-like [Solanu... 67 1e-09 XP_004244795.1 PREDICTED: cation/H(+) antiporter 15-like [Solanu... 67 1e-09 XP_016493967.1 PREDICTED: cation/H(+) antiporter 15-like isoform... 67 2e-09 XP_016513071.1 PREDICTED: cation/H(+) antiporter 15-like [Nicoti... 67 2e-09 XP_016493966.1 PREDICTED: cation/H(+) antiporter 15-like isoform... 67 2e-09 XP_009773648.1 PREDICTED: cation/H(+) antiporter 15-like [Nicoti... 67 2e-09 XP_009627829.1 PREDICTED: cation/H(+) antiporter 15-like [Nicoti... 67 2e-09 XP_019234140.1 PREDICTED: cation/H(+) antiporter 15-like [Nicoti... 66 2e-09 XP_006366098.1 PREDICTED: cation/H(+) antiporter 15-like [Solanu... 66 2e-09 >XP_017222233.1 PREDICTED: cation/H(+) antiporter 15-like [Daucus carota subsp. sativus] KZM85496.1 hypothetical protein DCAR_027082 [Daucus carota subsp. sativus] Length = 843 Score = 106 bits (265), Expect = 3e-23 Identities = 57/97 (58%), Positives = 69/97 (71%) Frame = +3 Query: 3 GLADWCDCPELGPIGDLFATSEFSSSLSVLVIQQYIRREESRDGSDMFAGSVVEQELESL 182 GLADWCDCPELGPIGDLFATSEFSSS SVLV+QQY R E S ++ +A S + L Sbjct: 748 GLADWCDCPELGPIGDLFATSEFSSSFSVLVMQQYTRSEGSEHETESYAES--SEAENEL 805 Query: 183 DWRPTNADSNPFESFTHREMEISQGSFSHKDRNHSHG 293 +WRP+NA SN + SF R+ E SF+H+ R+HS G Sbjct: 806 NWRPSNA-SNDYGSFGQRDTEFGHLSFNHR-RDHSLG 840 >XP_017245867.1 PREDICTED: cation/H(+) antiporter 15-like [Daucus carota subsp. sativus] KZM99841.1 hypothetical protein DCAR_012797 [Daucus carota subsp. sativus] Length = 832 Score = 96.3 bits (238), Expect = 1e-19 Identities = 53/98 (54%), Positives = 63/98 (64%) Frame = +3 Query: 3 GLADWCDCPELGPIGDLFATSEFSSSLSVLVIQQYIRREESRDGSDMFAGSVVEQELESL 182 GLADWCDCPELGPIGDLFATSEFSSS SVLV+QQYI+ E+ + S++ A S Q+ E L Sbjct: 747 GLADWCDCPELGPIGDLFATSEFSSSFSVLVMQQYIKTAETEE-SELSAESFARQDSEQL 805 Query: 183 DWRPTNADSNPFESFTHREMEISQGSFSHKDRNHSHGS 296 WR ++A + E GSF KD SH S Sbjct: 806 PWRASSAAT-----------EDVFGSFDSKDNKFSHES 832 >CDO99423.1 unnamed protein product [Coffea canephora] Length = 836 Score = 83.6 bits (205), Expect = 3e-15 Identities = 39/75 (52%), Positives = 54/75 (72%) Frame = +3 Query: 3 GLADWCDCPELGPIGDLFATSEFSSSLSVLVIQQYIRREESRDGSDMFAGSVVEQELESL 182 GLADWCDCPELGPIGDL TSEF S SVLV+QQY + RDGS AG++ ++ + + Sbjct: 752 GLADWCDCPELGPIGDLLVTSEFKSVFSVLVVQQYHKPSVPRDGSVRSAGTISQR--KDM 809 Query: 183 DWRPTNADSNPFESF 227 ++RP+ +++ FE + Sbjct: 810 EFRPSLSETETFEPY 824 >XP_012842208.1 PREDICTED: cation/H(+) antiporter 15-like [Erythranthe guttata] Length = 728 Score = 80.5 bits (197), Expect = 3e-14 Identities = 39/75 (52%), Positives = 50/75 (66%) Frame = +3 Query: 3 GLADWCDCPELGPIGDLFATSEFSSSLSVLVIQQYIRREESRDGSDMFAGSVVEQELESL 182 GL DWCDCPELGPIGDL TS+F SS SVL++QQY + + R+GS SV + + Sbjct: 646 GLDDWCDCPELGPIGDLLVTSQFESSFSVLIVQQYTKANKMREGSIRSTSSV--NYADEI 703 Query: 183 DWRPTNADSNPFESF 227 RP+ ++S FESF Sbjct: 704 VMRPSISESEGFESF 718 >EYU33342.1 hypothetical protein MIMGU_mgv1a001430mg [Erythranthe guttata] Length = 821 Score = 80.5 bits (197), Expect = 3e-14 Identities = 39/75 (52%), Positives = 50/75 (66%) Frame = +3 Query: 3 GLADWCDCPELGPIGDLFATSEFSSSLSVLVIQQYIRREESRDGSDMFAGSVVEQELESL 182 GL DWCDCPELGPIGDL TS+F SS SVL++QQY + + R+GS SV + + Sbjct: 739 GLDDWCDCPELGPIGDLLVTSQFESSFSVLIVQQYTKANKMREGSIRSTSSV--NYADEI 796 Query: 183 DWRPTNADSNPFESF 227 RP+ ++S FESF Sbjct: 797 VMRPSISESEGFESF 811 >XP_011082524.1 PREDICTED: cation/H(+) antiporter 15-like [Sesamum indicum] Length = 830 Score = 79.7 bits (195), Expect = 6e-14 Identities = 42/76 (55%), Positives = 50/76 (65%) Frame = +3 Query: 3 GLADWCDCPELGPIGDLFATSEFSSSLSVLVIQQYIRREESRDGSDMFAGSVVEQELESL 182 GLADWCDCPELGPIGDL TSEF S SVLV+QQY + ++GS A SV E Sbjct: 748 GLADWCDCPELGPIGDLLVTSEFESLFSVLVVQQYDNINKMKEGSIRSASSV--NYGEEF 805 Query: 183 DWRPTNADSNPFESFT 230 RP+ ++S FESF+ Sbjct: 806 ATRPSVSESEGFESFS 821 >XP_011096534.1 PREDICTED: cation/H(+) antiporter 15-like [Sesamum indicum] XP_011096535.1 PREDICTED: cation/H(+) antiporter 15-like [Sesamum indicum] Length = 827 Score = 78.6 bits (192), Expect = 1e-13 Identities = 42/74 (56%), Positives = 52/74 (70%) Frame = +3 Query: 3 GLADWCDCPELGPIGDLFATSEFSSSLSVLVIQQYIRREESRDGSDMFAGSVVEQELESL 182 GLADWCDCPELGPIGDL TSEF SS SVL++QQYI+ + +DGS A S E + Sbjct: 747 GLADWCDCPELGPIGDLLVTSEFESSFSVLIVQQYIKTD--KDGSIRSANS--GDFGEEV 802 Query: 183 DWRPTNADSNPFES 224 RP+ ++S+ FES Sbjct: 803 IMRPSVSESDGFES 816 >XP_019168772.1 PREDICTED: cation/H(+) antiporter 15-like [Ipomoea nil] Length = 855 Score = 77.4 bits (189), Expect = 4e-13 Identities = 39/80 (48%), Positives = 54/80 (67%), Gaps = 5/80 (6%) Frame = +3 Query: 3 GLADWCDCPELGPIGDLFATSEFSSSLSVLVIQQYIRRE----ESRDGSDMFAGSVVEQE 170 GLADWCDCPELGPIGDL TSEF S+ SVLV+QQY++ E +GS ++E + Sbjct: 766 GLADWCDCPELGPIGDLLVTSEFESAFSVLVVQQYMKSSRAGVEDSEGSSGRMSQMMENK 825 Query: 171 LESLDWRPTNADS-NPFESF 227 +E + R + +D+ + F+SF Sbjct: 826 VEEIPLRTSISDTESVFQSF 845 >EPS59090.1 hypothetical protein M569_15718, partial [Genlisea aurea] Length = 777 Score = 69.3 bits (168), Expect = 2e-10 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 3 GLADWCDCPELGPIGDLFATSEFSSSLSVLVIQQYI 110 GLADWCDCPELGPIGDL TSEF SS SV+V+QQY+ Sbjct: 742 GLADWCDCPELGPIGDLLVTSEFESSFSVVVVQQYV 777 >XP_019189223.1 PREDICTED: cation/H(+) antiporter 15-like [Ipomoea nil] Length = 868 Score = 68.6 bits (166), Expect = 4e-10 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = +3 Query: 3 GLADWCDCPELGPIGDLFATSEFSSSLSVLVIQQYIRREESRDGSDMFAGS 155 GLADWC+CPELG +GDL TSEF SS SVLV+QQY+R + G + S Sbjct: 760 GLADWCECPELGAVGDLLVTSEFESSFSVLVVQQYVRTNKGGAGGGSSSAS 810 >XP_016537581.1 PREDICTED: cation/H(+) antiporter 15-like [Capsicum annuum] Length = 831 Score = 67.8 bits (164), Expect = 7e-10 Identities = 39/84 (46%), Positives = 49/84 (58%), Gaps = 6/84 (7%) Frame = +3 Query: 3 GLADWCDCPELGPIGDLFATSEFSSSLSVLVIQQYIRREESRDGSDMFAGSVVEQ----- 167 GL DWCDCPELG IGDL TSEF S+ SVLV+QQY++ DGS GS+ E+ Sbjct: 743 GLVDWCDCPELGAIGDLLVTSEFDSTFSVLVMQQYVK--PIGDGSVNSYGSMSERIAGIG 800 Query: 168 -ELESLDWRPTNADSNPFESFTHR 236 E++ R + + F SF R Sbjct: 801 MEMDMDMQRADSESGDVFSSFRRR 824 >XP_015084045.1 PREDICTED: cation/H(+) antiporter 15-like [Solanum pennellii] Length = 831 Score = 67.4 bits (163), Expect = 1e-09 Identities = 41/84 (48%), Positives = 50/84 (59%), Gaps = 6/84 (7%) Frame = +3 Query: 3 GLADWCDCPELGPIGDLFATSEFSSSLSVLVIQQYIRREESRDGSDMFAGSVVEQEL--- 173 GL DWCDCPELG IGDL TSEF S+ SVLV+QQY++ DGS GS+ E+ Sbjct: 743 GLVDWCDCPELGAIGDLLVTSEFDSTFSVLVMQQYVK--PIGDGSVTSYGSMSERIAGIG 800 Query: 174 ESLDWRPTNADS---NPFESFTHR 236 +D +ADS + F SF R Sbjct: 801 MDMDMDMQHADSESGDVFSSFRRR 824 >XP_004244795.1 PREDICTED: cation/H(+) antiporter 15-like [Solanum lycopersicum] Length = 831 Score = 67.4 bits (163), Expect = 1e-09 Identities = 41/84 (48%), Positives = 50/84 (59%), Gaps = 6/84 (7%) Frame = +3 Query: 3 GLADWCDCPELGPIGDLFATSEFSSSLSVLVIQQYIRREESRDGSDMFAGSVVEQEL--- 173 GL DWCDCPELG IGDL TSEF S+ SVLV+QQY++ DGS GS+ E+ Sbjct: 743 GLVDWCDCPELGAIGDLLVTSEFDSTFSVLVMQQYVK--PIGDGSVTSYGSMSERIAGIG 800 Query: 174 ESLDWRPTNADS---NPFESFTHR 236 +D +ADS + F SF R Sbjct: 801 MDMDMDMQHADSESGDVFSSFRRR 824 >XP_016493967.1 PREDICTED: cation/H(+) antiporter 15-like isoform X2 [Nicotiana tabacum] Length = 724 Score = 66.6 bits (161), Expect = 2e-09 Identities = 39/83 (46%), Positives = 48/83 (57%), Gaps = 5/83 (6%) Frame = +3 Query: 3 GLADWCDCPELGPIGDLFATSEFSSSLSVLVIQQYIRREESRDGSDMFAGSVVEQELESL 182 GL DWCDCPELG IGDL TSEF S+ SVLV+QQY++ DGS GS+ E+ + Sbjct: 637 GLVDWCDCPELGAIGDLLVTSEFDSTFSVLVMQQYVK--PIGDGSVNSYGSMSERIGLGM 694 Query: 183 DW-----RPTNADSNPFESFTHR 236 D R + + F SF R Sbjct: 695 DMDMDMQRADSEAGDVFSSFRRR 717 >XP_016513071.1 PREDICTED: cation/H(+) antiporter 15-like [Nicotiana tabacum] Length = 830 Score = 66.6 bits (161), Expect = 2e-09 Identities = 39/83 (46%), Positives = 48/83 (57%), Gaps = 5/83 (6%) Frame = +3 Query: 3 GLADWCDCPELGPIGDLFATSEFSSSLSVLVIQQYIRREESRDGSDMFAGSVVEQELESL 182 GL DWCDCPELG IGDL TSEF S+ SVLV+QQY++ DGS GS+ E+ + Sbjct: 743 GLVDWCDCPELGAIGDLLVTSEFDSTFSVLVMQQYVK--PIGDGSVNSYGSMSERIGLGM 800 Query: 183 DW-----RPTNADSNPFESFTHR 236 D R + + F SF R Sbjct: 801 DMDMDMQRADSEAGDVFSSFRRR 823 >XP_016493966.1 PREDICTED: cation/H(+) antiporter 15-like isoform X1 [Nicotiana tabacum] Length = 830 Score = 66.6 bits (161), Expect = 2e-09 Identities = 39/83 (46%), Positives = 48/83 (57%), Gaps = 5/83 (6%) Frame = +3 Query: 3 GLADWCDCPELGPIGDLFATSEFSSSLSVLVIQQYIRREESRDGSDMFAGSVVEQELESL 182 GL DWCDCPELG IGDL TSEF S+ SVLV+QQY++ DGS GS+ E+ + Sbjct: 743 GLVDWCDCPELGAIGDLLVTSEFDSTFSVLVMQQYVK--PIGDGSVNSYGSMSERIGLGM 800 Query: 183 DW-----RPTNADSNPFESFTHR 236 D R + + F SF R Sbjct: 801 DMDMDMQRADSEAGDVFSSFRRR 823 >XP_009773648.1 PREDICTED: cation/H(+) antiporter 15-like [Nicotiana sylvestris] Length = 830 Score = 66.6 bits (161), Expect = 2e-09 Identities = 39/83 (46%), Positives = 48/83 (57%), Gaps = 5/83 (6%) Frame = +3 Query: 3 GLADWCDCPELGPIGDLFATSEFSSSLSVLVIQQYIRREESRDGSDMFAGSVVEQELESL 182 GL DWCDCPELG IGDL TSEF S+ SVLV+QQY++ DGS GS+ E+ + Sbjct: 743 GLVDWCDCPELGAIGDLLVTSEFDSTFSVLVMQQYVK--PIGDGSVNSYGSMSERIGLGM 800 Query: 183 DW-----RPTNADSNPFESFTHR 236 D R + + F SF R Sbjct: 801 DMDMDMQRADSEAGDVFSSFRRR 823 >XP_009627829.1 PREDICTED: cation/H(+) antiporter 15-like [Nicotiana tomentosiformis] Length = 830 Score = 66.6 bits (161), Expect = 2e-09 Identities = 39/83 (46%), Positives = 48/83 (57%), Gaps = 5/83 (6%) Frame = +3 Query: 3 GLADWCDCPELGPIGDLFATSEFSSSLSVLVIQQYIRREESRDGSDMFAGSVVEQELESL 182 GL DWCDCPELG IGDL TSEF S+ SVLV+QQY++ DGS GS+ E+ + Sbjct: 743 GLVDWCDCPELGAIGDLLVTSEFDSTFSVLVMQQYVK--PIGDGSVNSYGSMSERIGLGM 800 Query: 183 DW-----RPTNADSNPFESFTHR 236 D R + + F SF R Sbjct: 801 DMDMDMQRADSEAGDVFSSFRRR 823 >XP_019234140.1 PREDICTED: cation/H(+) antiporter 15-like [Nicotiana attenuata] OIT26935.1 cationh(+) antiporter 15 [Nicotiana attenuata] Length = 830 Score = 66.2 bits (160), Expect = 2e-09 Identities = 33/55 (60%), Positives = 39/55 (70%) Frame = +3 Query: 3 GLADWCDCPELGPIGDLFATSEFSSSLSVLVIQQYIRREESRDGSDMFAGSVVEQ 167 GL DWCDCPELG IGDL TSEF S+ SVLV+QQY++ DGS GS+ E+ Sbjct: 743 GLVDWCDCPELGAIGDLLVTSEFDSTFSVLVMQQYVK--PIGDGSVNSYGSMSER 795 >XP_006366098.1 PREDICTED: cation/H(+) antiporter 15-like [Solanum tuberosum] Length = 832 Score = 66.2 bits (160), Expect = 2e-09 Identities = 33/55 (60%), Positives = 39/55 (70%) Frame = +3 Query: 3 GLADWCDCPELGPIGDLFATSEFSSSLSVLVIQQYIRREESRDGSDMFAGSVVEQ 167 GL DWCDCPELG IGDL TSEF S+ SVLV+QQY++ DGS GS+ E+ Sbjct: 743 GLVDWCDCPELGAIGDLLVTSEFDSTFSVLVMQQYVK--PIGDGSVNSYGSMSER 795