BLASTX nr result
ID: Panax25_contig00048881
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00048881 (444 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAU42611.1 hypothetical protein LC_TR10529_c5_g1_i1_g.37156, par... 52 7e-06 >JAU42611.1 hypothetical protein LC_TR10529_c5_g1_i1_g.37156, partial [Noccaea caerulescens] Length = 115 Score = 52.0 bits (123), Expect = 7e-06 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = +3 Query: 141 SRSVWELYDILLRQLHWAILHRVIQAFGYF 230 SRSVWELY +LLR+ HWA++H + AFGYF Sbjct: 62 SRSVWELYHLLLRERHWALVHHAVTAFGYF 91