BLASTX nr result
ID: Panax25_contig00048735
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00048735 (520 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN11208.1 hypothetical protein DCAR_003864 [Daucus carota subsp... 64 1e-08 XP_017226294.1 PREDICTED: 187-kDa microtubule-associated protein... 64 1e-08 >KZN11208.1 hypothetical protein DCAR_003864 [Daucus carota subsp. sativus] Length = 1662 Score = 63.9 bits (154), Expect = 1e-08 Identities = 36/60 (60%), Positives = 44/60 (73%) Frame = +1 Query: 280 MEDPLVAAGDGSVEVSLNSELKKPMSAGSAKRTAIMAKPTVTIPSGTTRKRIEPKLGSQL 459 MEDPLVA G+GSVE+S N++ K P +AKRT +AKPTVT P GT +KR E K GS+L Sbjct: 1 MEDPLVA-GEGSVELSSNAKQKLPKLTENAKRTTHIAKPTVTGPIGTAKKRTELKGGSEL 59 >XP_017226294.1 PREDICTED: 187-kDa microtubule-associated protein AIR9 [Daucus carota subsp. sativus] XP_017226302.1 PREDICTED: 187-kDa microtubule-associated protein AIR9 [Daucus carota subsp. sativus] Length = 1712 Score = 63.9 bits (154), Expect = 1e-08 Identities = 36/60 (60%), Positives = 44/60 (73%) Frame = +1 Query: 280 MEDPLVAAGDGSVEVSLNSELKKPMSAGSAKRTAIMAKPTVTIPSGTTRKRIEPKLGSQL 459 MEDPLVA G+GSVE+S N++ K P +AKRT +AKPTVT P GT +KR E K GS+L Sbjct: 1 MEDPLVA-GEGSVELSSNAKQKLPKLTENAKRTTHIAKPTVTGPIGTAKKRTELKGGSEL 59